From fcedfddf00b3f994e4f4e40332ac7fc192c63244 Mon Sep 17 00:00:00 2001 From: polwex Date: Sun, 5 Oct 2025 21:56:51 +0700 Subject: claude is gud --- vere/ext/nasm/misc/Doxyfile | 752 +++++++++++++++++++++++++ vere/ext/nasm/misc/Nindent | 18 + vere/ext/nasm/misc/README | 2 + vere/ext/nasm/misc/c16.mac | 82 +++ vere/ext/nasm/misc/c32.mac | 52 ++ vere/ext/nasm/misc/crcgen.c | 44 ++ vere/ext/nasm/misc/emacstbl.pl | 215 +++++++ vere/ext/nasm/misc/exebin.mac | 57 ++ vere/ext/nasm/misc/exebin2.mac | 114 ++++ vere/ext/nasm/misc/fmtinsns.pl | 40 ++ vere/ext/nasm/misc/genfma.pl | 63 +++ vere/ext/nasm/misc/hints.txt | 26 + vere/ext/nasm/misc/magic | 6 + vere/ext/nasm/misc/myC32.mac | 121 ++++ vere/ext/nasm/misc/nasm.sl | 320 +++++++++++ vere/ext/nasm/misc/nasmstab | 296 ++++++++++ vere/ext/nasm/misc/omfdump.c | 516 +++++++++++++++++ vere/ext/nasm/misc/pmw.bat | 9 + vere/ext/nasm/misc/proc32.ash | 441 +++++++++++++++ vere/ext/nasm/misc/scitech.mac | 1222 ++++++++++++++++++++++++++++++++++++++++ vere/ext/nasm/misc/xcrcgen.c | 79 +++ 21 files changed, 4475 insertions(+) create mode 100644 vere/ext/nasm/misc/Doxyfile create mode 100755 vere/ext/nasm/misc/Nindent create mode 100644 vere/ext/nasm/misc/README create mode 100644 vere/ext/nasm/misc/c16.mac create mode 100644 vere/ext/nasm/misc/c32.mac create mode 100644 vere/ext/nasm/misc/crcgen.c create mode 100755 vere/ext/nasm/misc/emacstbl.pl create mode 100644 vere/ext/nasm/misc/exebin.mac create mode 100644 vere/ext/nasm/misc/exebin2.mac create mode 100755 vere/ext/nasm/misc/fmtinsns.pl create mode 100755 vere/ext/nasm/misc/genfma.pl create mode 100644 vere/ext/nasm/misc/hints.txt create mode 100644 vere/ext/nasm/misc/magic create mode 100644 vere/ext/nasm/misc/myC32.mac create mode 100644 vere/ext/nasm/misc/nasm.sl create mode 100644 vere/ext/nasm/misc/nasmstab create mode 100644 vere/ext/nasm/misc/omfdump.c create mode 100644 vere/ext/nasm/misc/pmw.bat create mode 100644 vere/ext/nasm/misc/proc32.ash create mode 100644 vere/ext/nasm/misc/scitech.mac create mode 100644 vere/ext/nasm/misc/xcrcgen.c (limited to 'vere/ext/nasm/misc') diff --git a/vere/ext/nasm/misc/Doxyfile b/vere/ext/nasm/misc/Doxyfile new file mode 100644 index 0000000..d3bd8d2 --- /dev/null +++ b/vere/ext/nasm/misc/Doxyfile @@ -0,0 +1,752 @@ +# Doxyfile 1.2.5 + +# This file describes the settings to be used by doxygen for a project +# +# All text after a hash (#) is considered a comment and will be ignored +# The format is: +# TAG = value [value, ...] +# For lists items can also be appended using: +# TAG += value [value, ...] +# Values that contain spaces should be placed between quotes (" ") + +#--------------------------------------------------------------------------- +# General configuration options +#--------------------------------------------------------------------------- + +# The PROJECT_NAME tag is a single word (or a sequence of words surrounded +# by quotes) that should identify the project. + +PROJECT_NAME = "NASM - the Netwide Assembler" + +# The PROJECT_NUMBER tag can be used to enter a project or revision number. +# This could be handy for archiving the generated documentation or +# if some version control system is used. + +PROJECT_NUMBER = 0.98 + +# The OUTPUT_DIRECTORY tag is used to specify the (relative or absolute) +# base path where the generated documentation will be put. +# If a relative path is entered, it will be relative to the location +# where doxygen was started. If left blank the current directory will be used. + +OUTPUT_DIRECTORY = doxy + +# The OUTPUT_LANGUAGE tag is used to specify the language in which all +# documentation generated by doxygen is written. Doxygen will use this +# information to generate all constant output in the proper language. +# The default language is English, other supported languages are: +# Dutch, French, Italian, Czech, Swedish, German, Finnish, Japanese, +# Korean, Hungarian, Norwegian, Spanish, Romanian, Russian, Croatian, +# Polish, Portuguese and Slovene. + +OUTPUT_LANGUAGE = English + +# If the EXTRACT_ALL tag is set to YES doxygen will assume all entities in +# documentation are documented, even if no documentation was available. +# Private class members and static file members will be hidden unless +# the EXTRACT_PRIVATE and EXTRACT_STATIC tags are set to YES + +EXTRACT_ALL = YES + +# If the EXTRACT_PRIVATE tag is set to YES all private members of a class +# will be included in the documentation. + +EXTRACT_PRIVATE = NO + +# If the EXTRACT_STATIC tag is set to YES all static members of a file +# will be included in the documentation. + +EXTRACT_STATIC = YES + +# If the HIDE_UNDOC_MEMBERS tag is set to YES, Doxygen will hide all +# undocumented members of documented classes, files or namespaces. +# If set to NO (the default) these members will be included in the +# various overviews, but no documentation section is generated. +# This option has no effect if EXTRACT_ALL is enabled. + +HIDE_UNDOC_MEMBERS = NO + +# If the HIDE_UNDOC_CLASSES tag is set to YES, Doxygen will hide all +# undocumented classes that are normally visible in the class hierarchy. +# If set to NO (the default) these class will be included in the various +# overviews. This option has no effect if EXTRACT_ALL is enabled. + +HIDE_UNDOC_CLASSES = NO + +# If the BRIEF_MEMBER_DESC tag is set to YES (the default) Doxygen will +# include brief member descriptions after the members that are listed in +# the file and class documentation (similar to JavaDoc). +# Set to NO to disable this. + +BRIEF_MEMBER_DESC = YES + +# If the REPEAT_BRIEF tag is set to YES (the default) Doxygen will prepend +# the brief description of a member or function before the detailed description. +# Note: if both HIDE_UNDOC_MEMBERS and BRIEF_MEMBER_DESC are set to NO, the +# brief descriptions will be completely suppressed. + +REPEAT_BRIEF = YES + +# If the ALWAYS_DETAILED_SEC and REPEAT_BRIEF tags are both set to YES then +# Doxygen will generate a detailed section even if there is only a brief +# description. + +ALWAYS_DETAILED_SEC = NO + +# If the FULL_PATH_NAMES tag is set to YES then Doxygen will prepend the full +# path before files name in the file list and in the header files. If set +# to NO the shortest path that makes the file name unique will be used. + +FULL_PATH_NAMES = NO + +# If the FULL_PATH_NAMES tag is set to YES then the STRIP_FROM_PATH tag +# can be used to strip a user defined part of the path. Stripping is +# only done if one of the specified strings matches the left-hand part of +# the path. It is allowed to use relative paths in the argument list. + +STRIP_FROM_PATH = + +# The INTERNAL_DOCS tag determines if documentation +# that is typed after a \internal command is included. If the tag is set +# to NO (the default) then the documentation will be excluded. +# Set it to YES to include the internal documentation. + +INTERNAL_DOCS = NO + +# If the CLASS_DIAGRAMS tag is set to YES (the default) Doxygen will +# generate a class diagram (in Html and LaTeX) for classes with base or +# super classes. Setting the tag to NO turns the diagrams off. + +CLASS_DIAGRAMS = YES + +# If the SOURCE_BROWSER tag is set to YES then a list of source files will +# be generated. Documented entities will be cross-referenced with these sources. + +SOURCE_BROWSER = YES + +# Setting the INLINE_SOURCES tag to YES will include the body +# of functions and classes directly in the documentation. + +INLINE_SOURCES = NO + +# Setting the STRIP_CODE_COMMENTS tag to YES (the default) will instruct +# doxygen to hide any special comment blocks from generated source code +# fragments. Normal C and C++ comments will always remain visible. + +STRIP_CODE_COMMENTS = YES + +# If the CASE_SENSE_NAMES tag is set to NO then Doxygen will only generate +# file names in lower case letters. If set to YES upper case letters are also +# allowed. This is useful if you have classes or files whose names only differ +# in case and if your file system supports case sensitive file names. Windows +# users are advised to set this option to NO. + +CASE_SENSE_NAMES = YES + +# If the HIDE_SCOPE_NAMES tag is set to NO (the default) then Doxygen +# will show members with their full class and namespace scopes in the +# documentation. If set to YES the scope will be hidden. + +HIDE_SCOPE_NAMES = NO + +# If the VERBATIM_HEADERS tag is set to YES (the default) then Doxygen +# will generate a verbatim copy of the header file for each class for +# which an include is specified. Set to NO to disable this. + +VERBATIM_HEADERS = YES + +# If the SHOW_INCLUDE_FILES tag is set to YES (the default) then Doxygen +# will put list of the files that are included by a file in the documentation +# of that file. + +SHOW_INCLUDE_FILES = YES + +# If the JAVADOC_AUTOBRIEF tag is set to YES then Doxygen +# will interpret the first line (until the first dot) of a JavaDoc-style +# comment as the brief description. If set to NO, the JavaDoc +# comments will behave just like the Qt-style comments (thus requiring an +# explicit @brief command for a brief description. + +JAVADOC_AUTOBRIEF = NO + +# If the INHERIT_DOCS tag is set to YES (the default) then an undocumented +# member inherits the documentation from any documented member that it +# reimplements. + +INHERIT_DOCS = YES + +# If the INLINE_INFO tag is set to YES (the default) then a tag [inline] +# is inserted in the documentation for inline members. + +INLINE_INFO = YES + +# If the SORT_MEMBER_DOCS tag is set to YES (the default) then doxygen +# will sort the (detailed) documentation of file and class members +# alphabetically by member name. If set to NO the members will appear in +# declaration order. + +SORT_MEMBER_DOCS = YES + +# If member grouping is used in the documentation and the DISTRIBUTE_GROUP_DOC +# tag is set to YES, then doxygen will reuse the documentation of the first +# member in the group (if any) for the other members of the group. By default +# all members of a group must be documented explicitly. + +DISTRIBUTE_GROUP_DOC = NO + +# The TAB_SIZE tag can be used to set the number of spaces in a tab. +# Doxygen uses this value to replace tabs by spaces in code fragments. + +TAB_SIZE = 4 + +# The ENABLE_SECTIONS tag can be used to enable conditional +# documentation sections, marked by \if sectionname ... \endif. + +ENABLED_SECTIONS = + +# The GENERATE_TODOLIST tag can be used to enable (YES) or +# disable (NO) the todo list. This list is created by putting \todo +# commands in the documentation. + +GENERATE_TODOLIST = YES + +# The GENERATE_TESTLIST tag can be used to enable (YES) or +# disable (NO) the test list. This list is created by putting \test +# commands in the documentation. + +GENERATE_TESTLIST = YES + +# This tag can be used to specify a number of aliases that acts +# as commands in the documentation. An alias has the form "name=value". +# For example adding "sideeffect=\par Side Effects:\n" will allow you to +# put the command \sideeffect (or @sideeffect) in the documentation, which +# will result in a user defined paragraph with heading "Side Effects:". +# You can put \n's in the value part of an alias to insert newlines. + +ALIASES = + +# The MAX_INITIALIZER_LINES tag determines the maximum number of lines +# the initial value of a variable or define consist of for it to appear in +# the documentation. If the initializer consists of more lines than specified +# here it will be hidden. Use a value of 0 to hide initializers completely. +# The appearance of the initializer of individual variables and defines in the +# documentation can be controlled using \showinitializer or \hideinitializer +# command in the documentation regardless of this setting. + +MAX_INITIALIZER_LINES = 30 + +# Set the OPTIMIZE_OUTPUT_FOR_C tag to YES if your project consists of C sources +# only. Doxygen will then generate output that is more tailored for C. +# For instance some of the names that are used will be different. The list +# of all members will be omitted, etc. + +OPTIMIZE_OUTPUT_FOR_C = NO + +#--------------------------------------------------------------------------- +# configuration options related to warning and progress messages +#--------------------------------------------------------------------------- + +# The QUIET tag can be used to turn on/off the messages that are generated +# by doxygen. Possible values are YES and NO. If left blank NO is used. + +QUIET = NO + +# The WARNINGS tag can be used to turn on/off the warning messages that are +# generated by doxygen. Possible values are YES and NO. If left blank +# NO is used. + +WARNINGS = YES + +# If WARN_IF_UNDOCUMENTED is set to YES, then doxygen will generate warnings +# for undocumented members. If EXTRACT_ALL is set to YES then this flag will +# automatically be disabled. + +WARN_IF_UNDOCUMENTED = YES + +# The WARN_FORMAT tag determines the format of the warning messages that +# doxygen can produce. The string should contain the $file, $line, and $text +# tags, which will be replaced by the file and line number from which the +# warning originated and the warning text. + +WARN_FORMAT = "$file:$line: $text" + +# The WARN_LOGFILE tag can be used to specify a file to which warning +# and error messages should be written. If left blank the output is written +# to stderr. + +WARN_LOGFILE = + +#--------------------------------------------------------------------------- +# configuration options related to the input files +#--------------------------------------------------------------------------- + +# The INPUT tag can be used to specify the files and/or directories that contain +# documented source files. You may enter file names like "myfile.cpp" or +# directories like "/usr/src/myproject". Separate the files or directories +# with spaces. + +INPUT = . + +# If the value of the INPUT tag contains directories, you can use the +# FILE_PATTERNS tag to specify one or more wildcard pattern (like *.cpp +# and *.h) to filter out the source-files in the directories. If left +# blank all files are included. + +FILE_PATTERNS = *.c *.h + +# The RECURSIVE tag can be used to turn specify whether or not subdirectories +# should be searched for input files as well. Possible values are YES and NO. +# If left blank NO is used. + +RECURSIVE = NO + +# The EXCLUDE tag can be used to specify files and/or directories that should +# excluded from the INPUT source files. This way you can easily exclude a +# subdirectory from a directory tree whose root is specified with the INPUT tag. + +EXCLUDE = + +# If the value of the INPUT tag contains directories, you can use the +# EXCLUDE_PATTERNS tag to specify one or more wildcard patterns to exclude +# certain files from those directories. + +EXCLUDE_PATTERNS = + +# The EXAMPLE_PATH tag can be used to specify one or more files or +# directories that contain example code fragments that are included (see +# the \include command). + +EXAMPLE_PATH = + +# If the value of the EXAMPLE_PATH tag contains directories, you can use the +# EXAMPLE_PATTERNS tag to specify one or more wildcard pattern (like *.cpp +# and *.h) to filter out the source-files in the directories. If left +# blank all files are included. + +EXAMPLE_PATTERNS = + +# The IMAGE_PATH tag can be used to specify one or more files or +# directories that contain image that are included in the documentation (see +# the \image command). + +IMAGE_PATH = + +# The INPUT_FILTER tag can be used to specify a program that doxygen should +# invoke to filter for each input file. Doxygen will invoke the filter program +# by executing (via popen()) the command , where +# is the value of the INPUT_FILTER tag, and is the name of an +# input file. Doxygen will then use the output that the filter program writes +# to standard output. + +INPUT_FILTER = + +# If the FILTER_SOURCE_FILES tag is set to YES, the input filter (if set using +# INPUT_FILTER) will be used to filter the input files when producing source +# files to browse. + +FILTER_SOURCE_FILES = NO + +#--------------------------------------------------------------------------- +# configuration options related to the alphabetical class index +#--------------------------------------------------------------------------- + +# If the ALPHABETICAL_INDEX tag is set to YES, an alphabetical index +# of all compounds will be generated. Enable this if the project +# contains a lot of classes, structs, unions or interfaces. + +ALPHABETICAL_INDEX = NO + +# If the alphabetical index is enabled (see ALPHABETICAL_INDEX) then +# the COLS_IN_ALPHA_INDEX tag can be used to specify the number of columns +# in which this list will be split (can be a number in the range [1..20]) + +COLS_IN_ALPHA_INDEX = 5 + +# In case all classes in a project start with a common prefix, all +# classes will be put under the same header in the alphabetical index. +# The IGNORE_PREFIX tag can be used to specify one or more prefixes that +# should be ignored while generating the index headers. + +IGNORE_PREFIX = + +#--------------------------------------------------------------------------- +# configuration options related to the HTML output +#--------------------------------------------------------------------------- + +# If the GENERATE_HTML tag is set to YES (the default) Doxygen will +# generate HTML output. + +GENERATE_HTML = YES + +# The HTML_OUTPUT tag is used to specify where the HTML docs will be put. +# If a relative path is entered the value of OUTPUT_DIRECTORY will be +# put in front of it. If left blank `html' will be used as the default path. + +HTML_OUTPUT = html + +# The HTML_HEADER tag can be used to specify a personal HTML header for +# each generated HTML page. If it is left blank doxygen will generate a +# standard header. + +HTML_HEADER = + +# The HTML_FOOTER tag can be used to specify a personal HTML footer for +# each generated HTML page. If it is left blank doxygen will generate a +# standard footer. + +HTML_FOOTER = + +# The HTML_STYLESHEET tag can be used to specify a user defined cascading +# style sheet that is used by each HTML page. It can be used to +# fine-tune the look of the HTML output. If the tag is left blank doxygen +# will generate a default style sheet + +HTML_STYLESHEET = + +# If the HTML_ALIGN_MEMBERS tag is set to YES, the members of classes, +# files or namespaces will be aligned in HTML using tables. If set to +# NO a bullet list will be used. + +HTML_ALIGN_MEMBERS = YES + +# If the GENERATE_HTMLHELP tag is set to YES, additional index files +# will be generated that can be used as input for tools like the +# Microsoft HTML help workshop to generate a compressed HTML help file (.chm) +# of the generated HTML documentation. + +GENERATE_HTMLHELP = NO + +# The DISABLE_INDEX tag can be used to turn on/off the condensed index at +# top of each HTML page. The value NO (the default) enables the index and +# the value YES disables it. + +DISABLE_INDEX = NO + +# This tag can be used to set the number of enum values (range [1..20]) +# that doxygen will group on one line in the generated HTML documentation. + +ENUM_VALUES_PER_LINE = 4 + +# If the GENERATE_TREEVIEW tag is set to YES, a side panel will be +# generated containing a tree-like index structure (just like the one that +# is generated for HTML Help). For this to work a browser that supports +# JavaScript and frames is required (for instance Netscape 4.0+ +# or Internet explorer 4.0+). + +GENERATE_TREEVIEW = YES + +# If the treeview is enabled (see GENERATE_TREEVIEW) then this tag can be +# used to set the initial width (in pixels) of the frame in which the tree +# is shown. + +TREEVIEW_WIDTH = 250 + +#--------------------------------------------------------------------------- +# configuration options related to the LaTeX output +#--------------------------------------------------------------------------- + +# If the GENERATE_LATEX tag is set to YES (the default) Doxygen will +# generate Latex output. + +GENERATE_LATEX = YES + +# The LATEX_OUTPUT tag is used to specify where the LaTeX docs will be put. +# If a relative path is entered the value of OUTPUT_DIRECTORY will be +# put in front of it. If left blank `latex' will be used as the default path. + +LATEX_OUTPUT = latex + +# If the COMPACT_LATEX tag is set to YES Doxygen generates more compact +# LaTeX documents. This may be useful for small projects and may help to +# save some trees in general. + +COMPACT_LATEX = NO + +# The PAPER_TYPE tag can be used to set the paper type that is used +# by the printer. Possible values are: a4, a4wide, letter, legal and +# executive. If left blank a4wide will be used. + +PAPER_TYPE = a4wide + +# The EXTRA_PACKAGES tag can be to specify one or more names of LaTeX +# packages that should be included in the LaTeX output. + +EXTRA_PACKAGES = + +# The LATEX_HEADER tag can be used to specify a personal LaTeX header for +# the generated latex document. The header should contain everything until +# the first chapter. If it is left blank doxygen will generate a +# standard header. Notice: only use this tag if you know what you are doing! + +LATEX_HEADER = + +# If the PDF_HYPERLINKS tag is set to YES, the LaTeX that is generated +# is prepared for conversion to pdf (using ps2pdf). The pdf file will +# contain links (just like the HTML output) instead of page references +# This makes the output suitable for online browsing using a pdf viewer. + +PDF_HYPERLINKS = NO + +# If the USE_PDFLATEX tag is set to YES, pdflatex will be used instead of +# plain latex in the generated Makefile. Set this option to YES to get a +# higher quality PDF documentation. + +USE_PDFLATEX = NO + +# If the LATEX_BATCHMODE tag is set to YES, doxygen will add the \\batchmode. +# command to the generated LaTeX files. This will instruct LaTeX to keep +# running if errors occur, instead of asking the user for help. +# This option is also used when generating formulas in HTML. + +LATEX_BATCHMODE = NO + +#--------------------------------------------------------------------------- +# configuration options related to the RTF output +#--------------------------------------------------------------------------- + +# If the GENERATE_RTF tag is set to YES Doxygen will generate RTF output +# The RTF output is optimised for Word 97 and may not look very pretty with +# other RTF readers or editors. + +GENERATE_RTF = YES + +# The RTF_OUTPUT tag is used to specify where the RTF docs will be put. +# If a relative path is entered the value of OUTPUT_DIRECTORY will be +# put in front of it. If left blank `rtf' will be used as the default path. + +RTF_OUTPUT = rtf + +# If the COMPACT_RTF tag is set to YES Doxygen generates more compact +# RTF documents. This may be useful for small projects and may help to +# save some trees in general. + +COMPACT_RTF = NO + +# If the RTF_HYPERLINKS tag is set to YES, the RTF that is generated +# will contain hyperlink fields. The RTF file will +# contain links (just like the HTML output) instead of page references. +# This makes the output suitable for online browsing using a WORD or other. +# programs which support those fields. +# Note: wordpad (write) and others do not support links. + +RTF_HYPERLINKS = NO + +# Load stylesheet definitions from file. Syntax is similar to doxygen's +# config file, i.e. a series of assignments. You only have to provide +# replacements, missing definitions are set to their default value. + +RTF_STYLESHEET_FILE = + +#--------------------------------------------------------------------------- +# configuration options related to the man page output +#--------------------------------------------------------------------------- + +# If the GENERATE_MAN tag is set to YES (the default) Doxygen will +# generate man pages + +GENERATE_MAN = YES + +# The MAN_OUTPUT tag is used to specify where the man pages will be put. +# If a relative path is entered the value of OUTPUT_DIRECTORY will be +# put in front of it. If left blank `man' will be used as the default path. + +MAN_OUTPUT = man + +# The MAN_EXTENSION tag determines the extension that is added to +# the generated man pages (default is the subroutine's section .3) + +MAN_EXTENSION = .3 + +#--------------------------------------------------------------------------- +# Configuration options related to the preprocessor +#--------------------------------------------------------------------------- + +# If the ENABLE_PREPROCESSING tag is set to YES (the default) Doxygen will +# evaluate all C-preprocessor directives found in the sources and include +# files. + +ENABLE_PREPROCESSING = YES + +# If the MACRO_EXPANSION tag is set to YES Doxygen will expand all macro +# names in the source code. If set to NO (the default) only conditional +# compilation will be performed. Macro expansion can be done in a controlled +# way by setting EXPAND_ONLY_PREDEF to YES. + +MACRO_EXPANSION = NO + +# If the EXPAND_ONLY_PREDEF and MACRO_EXPANSION tags are both set to YES +# then the macro expansion is limited to the macros specified with the +# PREDEFINED and EXPAND_AS_PREDEFINED tags. + +EXPAND_ONLY_PREDEF = NO + +# If the SEARCH_INCLUDES tag is set to YES (the default) the includes files +# in the INCLUDE_PATH (see below) will be search if a #include is found. + +SEARCH_INCLUDES = YES + +# The INCLUDE_PATH tag can be used to specify one or more directories that +# contain include files that are not input files but should be processed by +# the preprocessor. + +INCLUDE_PATH = + +# You can use the INCLUDE_FILE_PATTERNS tag to specify one or more wildcard +# patterns (like *.h and *.hpp) to filter out the header-files in the +# directories. If left blank, the patterns specified with FILE_PATTERNS will +# be used. + +INCLUDE_FILE_PATTERNS = + +# The PREDEFINED tag can be used to specify one or more macro names that +# are defined before the preprocessor is started (similar to the -D option of +# gcc). The argument of the tag is a list of macros of the form: name +# or name=definition (no spaces). If the definition and the = are +# omitted =1 is assumed. + +PREDEFINED = + +# If the MACRO_EXPANSION and EXPAND_PREDEF_ONLY tags are set to YES then +# this tag can be used to specify a list of macro names that should be expanded. +# The macro definition that is found in the sources will be used. +# Use the PREDEFINED tag if you want to use a different macro definition. + +EXPAND_AS_DEFINED = + +#--------------------------------------------------------------------------- +# Configuration::addtions related to external references +#--------------------------------------------------------------------------- + +# The TAGFILES tag can be used to specify one or more tagfiles. + +TAGFILES = + +# When a file name is specified after GENERATE_TAGFILE, doxygen will create +# a tag file that is based on the input files it reads. + +GENERATE_TAGFILE = + +# If the ALLEXTERNALS tag is set to YES all external classes will be listed +# in the class index. If set to NO only the inherited external classes +# will be listed. + +ALLEXTERNALS = NO + +# The PERL_PATH should be the absolute path and name of the perl script +# interpreter (i.e. the result of `which perl'). + +PERL_PATH = /usr/bin/perl + +#--------------------------------------------------------------------------- +# Configuration options related to the dot tool +#--------------------------------------------------------------------------- + +# If you set the HAVE_DOT tag to YES then doxygen will assume the dot tool is +# available from the path. This tool is part of Graphviz, a graph visualization +# toolkit from AT&T and Lucent Bell Labs. The other options in this section +# have no effect if this option is set to NO (the default) + +HAVE_DOT = NO + +# If the CLASS_GRAPH and HAVE_DOT tags are set to YES then doxygen +# will generate a graph for each documented class showing the direct and +# indirect inheritance relations. Setting this tag to YES will force the +# the CLASS_DIAGRAMS tag to NO. + +CLASS_GRAPH = YES + +# If the COLLABORATION_GRAPH and HAVE_DOT tags are set to YES then doxygen +# will generate a graph for each documented class showing the direct and +# indirect implementation dependencies (inheritance, containment, and +# class references variables) of the class with other documented classes. + +COLLABORATION_GRAPH = YES + +# If the ENABLE_PREPROCESSING, INCLUDE_GRAPH, and HAVE_DOT tags are set to +# YES then doxygen will generate a graph for each documented file showing +# the direct and indirect include dependencies of the file with other +# documented files. + +INCLUDE_GRAPH = YES + +# If the ENABLE_PREPROCESSING, INCLUDED_BY_GRAPH, and HAVE_DOT tags are set to +# YES then doxygen will generate a graph for each documented header file showing +# the documented files that directly or indirectly include this file + +INCLUDED_BY_GRAPH = YES + +# If the GRAPHICAL_HIERARCHY and HAVE_DOT tags are set to YES then doxygen +# will graphical hierarchy of all classes instead of a textual one. + +GRAPHICAL_HIERARCHY = YES + +# The tag DOT_PATH can be used to specify the path where the dot tool can be +# found. If left blank, it is assumed the dot tool can be found on the path. + +DOT_PATH = + +# The MAX_DOT_GRAPH_WIDTH tag can be used to set the maximum allowed width +# (in pixels) of the graphs generated by dot. If a graph becomes larger than +# this value, doxygen will try to truncate the graph, so that it fits within +# the specified constraint. Beware that most browsers cannot cope with very +# large images. + +MAX_DOT_GRAPH_WIDTH = 1024 + +# The MAX_DOT_GRAPH_HEIGHT tag can be used to set the maximum allows height +# (in pixels) of the graphs generated by dot. If a graph becomes larger than +# this value, doxygen will try to truncate the graph, so that it fits within +# the specified constraint. Beware that most browsers cannot cope with very +# large images. + +MAX_DOT_GRAPH_HEIGHT = 1024 + +# If the GENERATE_LEGEND tag is set to YES (the default) Doxygen will +# generate a legend page explaining the meaning of the various boxes and +# arrows in the dot generated graphs. + +GENERATE_LEGEND = YES + +#--------------------------------------------------------------------------- +# Configuration::addtions related to the search engine +#--------------------------------------------------------------------------- + +# The SEARCHENGINE tag specifies whether or not a search engine should be +# used. If set to NO the values of all tags below this one will be ignored. + +SEARCHENGINE = NO + +# The CGI_NAME tag should be the name of the CGI script that +# starts the search engine (doxysearch) with the correct parameters. +# A script with this name will be generated by doxygen. + +CGI_NAME = search.cgi + +# The CGI_URL tag should be the absolute URL to the directory where the +# cgi binaries are located. See the documentation of your http daemon for +# details. + +CGI_URL = + +# The DOC_URL tag should be the absolute URL to the directory where the +# documentation is located. If left blank the absolute path to the +# documentation, with file:// prepended to it, will be used. + +DOC_URL = + +# The DOC_ABSPATH tag should be the absolute path to the directory where the +# documentation is located. If left blank the directory on the local machine +# will be used. + +DOC_ABSPATH = + +# The BIN_ABSPATH tag must point to the directory where the doxysearch binary +# is installed. + +BIN_ABSPATH = /usr/local/bin/ + +# The EXT_DOC_PATHS tag can be used to specify one or more paths to +# documentation generated for other projects. This allows doxysearch to search +# the documentation for these projects as well. + +EXT_DOC_PATHS = diff --git a/vere/ext/nasm/misc/Nindent b/vere/ext/nasm/misc/Nindent new file mode 100755 index 0000000..a6c806c --- /dev/null +++ b/vere/ext/nasm/misc/Nindent @@ -0,0 +1,18 @@ +#!/bin/sh +PARAM="-npro -kr -i8 -ts8 -sob -l80 -ss -ncs -cp1" +RES=`indent --version` +V1=`echo $RES | cut -d' ' -f3 | cut -d'.' -f1` +V2=`echo $RES | cut -d' ' -f3 | cut -d'.' -f2` +V3=`echo $RES | cut -d' ' -f3 | cut -d'.' -f3` +if [ $V1 -gt 2 ]; then + PARAM="$PARAM -il0" +elif [ $V1 -eq 2 ]; then + if [ $V2 -gt 2 ]; then + PARAM="$PARAM -il0"; + elif [ $V2 -eq 2 ]; then + if [ $V3 -ge 10 ]; then + PARAM="$PARAM -il0" + fi + fi +fi +exec indent $PARAM "$@" diff --git a/vere/ext/nasm/misc/README b/vere/ext/nasm/misc/README new file mode 100644 index 0000000..f39ba4d --- /dev/null +++ b/vere/ext/nasm/misc/README @@ -0,0 +1,2 @@ +There are various helpful bits and pieces for NASM, +including but not limited to Simon photograph =) diff --git a/vere/ext/nasm/misc/c16.mac b/vere/ext/nasm/misc/c16.mac new file mode 100644 index 0000000..50b5d5e --- /dev/null +++ b/vere/ext/nasm/misc/c16.mac @@ -0,0 +1,82 @@ +; NASM macro set to make interfacing to 16-bit programs easier -*- nasm -*- + + + +%imacro proc 1 ; begin a procedure definition + +%push proc + + global %1 + +%1: push bp + + mov bp,sp + +%ifdef FARCODE PASCAL ; arguments may start at bp+4 or bp+6 + +%assign %$arg 6 + +%define %$firstarg 6 + +%else + +%assign %$arg 4 + +%define %$firstarg 4 + +%endif + +%define %$procname %1 + +%endmacro + + + +%imacro arg 0-1 2 ; used with the argument name as a label + +%00 equ %$arg + + ; we could possibly be adding some + + ; debug information at this point...? + +%assign %$arg %1+%$arg + +%endmacro + + + +%imacro endproc 0 + +%ifnctx proc + +%error Mismatched `endproc'/`proc' + +%else + + mov sp,bp + + pop bp + +%ifdef PASCAL + + retf %$arg - %$firstarg + +%elifdef FARCODE + + retf + +%else + + retn + +%endif + +__end_%$procname: ; useful for calculating function size + +%pop + +%endif + +%endmacro + diff --git a/vere/ext/nasm/misc/c32.mac b/vere/ext/nasm/misc/c32.mac new file mode 100644 index 0000000..f0c116b --- /dev/null +++ b/vere/ext/nasm/misc/c32.mac @@ -0,0 +1,52 @@ +; NASM macro set to make interfacing to 32-bit programs easier -*- nasm -*- + + + +%imacro proc 1 ; begin a procedure definition + +%push proc + + global %1 + +%1: push ebp + + mov ebp,esp + +%assign %$arg 8 + +%define %$procname %1 + +%endmacro + + + +%imacro arg 0-1 4 ; used with the argument name as a label + +%00 equ %$arg + +%assign %$arg %1+%$arg + +%endmacro + + + +%imacro endproc 0 + +%ifnctx proc + +%error Mismatched `endproc'/`proc' + +%else + + leave + + ret + +__end_%$procname: ; useful for calculating function size + +%pop + +%endif + +%endmacro + diff --git a/vere/ext/nasm/misc/crcgen.c b/vere/ext/nasm/misc/crcgen.c new file mode 100644 index 0000000..f11e252 --- /dev/null +++ b/vere/ext/nasm/misc/crcgen.c @@ -0,0 +1,44 @@ +#include +#include + +int main(int argc, char *argv[]) +{ + /* Polynomial in bit-reversed notation */ + uint64_t poly; + uint64_t crctab[256], v; + int i, j; + + poly = strtoumax(argv[1], NULL, 0); + + printf("/* C */\n"); + printf("static const uint64_t crc64_tab[256] = {\n"); + for (i = 0; i < 256; i++) { + v = i; + for (j = 0; j < 8; j++) + v = (v >> 1) ^ ((v & 1) ? poly : 0); + crctab[i] = v; + } + + for (i = 0; i < 256; i += 2) { + printf(" /* %02x */ UINT64_C(0x%016"PRIx64"), " + "UINT64_C(0x%016"PRIx64")%s\n", + i, crctab[i], crctab[i+1], (i == 254) ? "" : ","); + } + printf("};\n\n"); + + printf("# perl\n"); + printf("@crc64_tab = (\n"); + for (i = 0; i < 256; i += 2) { + printf(" [0x%08"PRIx32", 0x%08"PRIx32"], " + "[0x%08"PRIx32", 0x%08"PRIx32"]%-1s # %02x\n", + (uint32_t)(crctab[i] >> 32), + (uint32_t)(crctab[i]), + (uint32_t)(crctab[i+1] >> 32), + (uint32_t)(crctab[i+1]), + (i == 254) ? "" : ",", + i); + } + printf(");\n"); + + return 0; +} diff --git a/vere/ext/nasm/misc/emacstbl.pl b/vere/ext/nasm/misc/emacstbl.pl new file mode 100755 index 0000000..341810d --- /dev/null +++ b/vere/ext/nasm/misc/emacstbl.pl @@ -0,0 +1,215 @@ +#!/usr/bin/perl +# +# Automatically produce some tables useful for a NASM major mode +# + +use integer; +use strict; +use File::Spec; + +my($outfile, $srcdir, $objdir) = @ARGV; + +if (!defined($outfile)) { + die "Usage: $0 outfile srcdir objdir\n"; +} + +$srcdir = File::Spec->curdir() unless (defined($srcdir)); +$objdir = $srcdir unless (defined($objdir)); + +my %tokens = (); + +sub xpush($@) { + my $ref = shift @_; + + $$ref = [] unless (defined($$ref)); + return push(@$$ref, @_); +} + +# Combine some specific token types +my %override = ( 'id' => 'special', + 'float' => 'function', + 'floatize' => 'function', + 'strfunc' => 'function', + 'ifunc' => 'function', + 'insn' => 'instruction', + 'reg' => 'register', + 'seg' => 'special', + 'wrt' => 'special' ); + +sub read_tokhash_c($) { + my($tokhash_c) = @_; + + open(my $th, '<', $tokhash_c) + or die "$0:$tokhash_c: $!\n"; + + my $l; + my $tokendata = 0; + while (defined($l = <$th>)) { + if ($l =~ /\bstruct tokendata tokendata\[/) { + $tokendata = 1; + next; + } elsif (!$tokendata) { + next; + } + + last if ($l =~ /\}\;/); + + if ($l =~ /^\s*\{\s*\"(.*?)\",.*?,\s*TOKEN_(\w+),.*\}/) { + my $token = $1; + my $type = lc($2); + + if ($override{$type}) { + $type = $override{$type}; + } elsif ($token !~ /^\w/) { + $type = 'operator'; + } elsif ($token =~ /^__\?masm_.*\?__$/) { + next; + } + xpush(\$tokens{$type}, $token); + if ($token =~ /^__\?(.*)\?__$/) { + # Also encode the "user" (macro) form without __?...?__ + xpush(\$tokens{$type}, $1); + } + } + } + close($th); +} + +sub read_pptok_c($) { + my($pptok_c) = @_; + + open(my $pt, '<', $pptok_c) + or die "$0:$pptok_c: $!\n"; + + my $l; + my $pp_dir = 0; + + while (defined($l = <$pt>)) { + if ($l =~ /\bpp_directives\[/) { + $pp_dir = 1; + next; + } elsif (!$pp_dir) { + next; + } + + last if ($l =~ /\}\;/); + + if ($l =~ /^\s*\"(.*?)\"/) { + xpush(\$tokens{'pp-directive'}, $1); + } + } + close($pt); +} + +sub read_directiv_dat($) { + my($directiv_dat) = @_; + + open(my $dd, '<', $directiv_dat) + or die "$0:$directiv_dat: $!\n"; + + my $l; + my $directiv = 0; + + while (defined($l = <$dd>)) { + if ($l =~ /^\; ---.*?(pragma)?/) { + $directiv = ($1 ne 'pragma'); + next; + } elsif (!$directiv) { + next; + } + + if ($l =~ /^\s*(\w+)/) { + xpush(\$tokens{'directive'}, $1); + } + } + + close($dd); +} + +my $version; +sub read_version($) { + my($vfile) = @_; + open(my $v, '<', $vfile) + or die "$0:$vfile: $!\n"; + + $version = <$v>; + chomp $version; + + close($v); +} + +sub make_lines($$@) { + my $maxline = shift @_; + my $indent = shift @_; + + # The first line isn't explicitly indented and the last line + # doesn't end in "\n"; assumed the surrounding formatter wants + # do control that + my $linepos = 0; + my $linewidth = $maxline - $indent; + + my $line = ''; + my @lines = (); + + foreach my $w (@_) { + my $l = length($w); + + if ($linepos > 0 && $linepos+$l+1 >= $linewidth) { + $line .= "\n" . (' ' x $indent); + push(@lines, $line); + $linepos = 0; + $line = ''; + } + if ($linepos > 0) { + $line .= ' '; + $linepos++; + } + $line .= $w; + $linepos += $l; + } + + if ($linepos > 0) { + push(@lines, $line); + } + + return @lines; +} + +sub quote_for_emacs(@) { + return map { s/[\\\"\']/\\$1/g; '"'.$_.'"' } @_; +} + +sub write_output($) { + my($outfile) = @_; + + open(my $out, '>', $outfile) + or die "$0:$outfile: $!\n"; + + my($vol,$dir,$file) = File::Spec->splitpath($outfile); + + print $out ";;; ${file} --- lists of NASM assembler tokens\n"; + print $out ";;;\n"; + print $out ";;; This file contains list of tokens from the NASM x86\n"; + print $out ";;; assembler, automatically extracted from NASM ${version}.\n"; + print $out ";;;\n"; + print $out ";;; This file is intended to be (require)d from a `nasm-mode\'\n"; + print $out ";;; major mode definition.\n"; + + foreach my $type (sort keys(%tokens)) { + print $out "\n(defconst nasm-${type}\n"; + print $out " \'("; + + print $out make_lines(78, 4, quote_for_emacs(sort @{$tokens{$type}})); + print $out ")\n"; + print $out " \"NASM ${version} ${type} tokens for `nasm-mode\'.\")\n"; + } + + close($out); +} + +read_tokhash_c(File::Spec->catfile($objdir, 'asm', 'tokhash.c')); +read_pptok_c(File::Spec->catfile($objdir, 'asm', 'pptok.c')); +read_directiv_dat(File::Spec->catfile($srcdir, 'asm', 'directiv.dat')); +read_version(File::Spec->catfile($srcdir, 'version')); + +write_output($outfile); diff --git a/vere/ext/nasm/misc/exebin.mac b/vere/ext/nasm/misc/exebin.mac new file mode 100644 index 0000000..8d1eaf8 --- /dev/null +++ b/vere/ext/nasm/misc/exebin.mac @@ -0,0 +1,57 @@ +; -*- nasm -*- +; NASM macro file to allow the `bin' output format to generate +; simple .EXE files by constructing the EXE header by hand. +; Adapted from a contribution by Yann Guidon + +%define EXE_stack_size EXE_realstacksize + +%macro EXE_begin 0 + ORG 0E0h + section .text + +header_start: + db 4Dh,5Ah ; EXE file signature + dw EXE_allocsize % 512 + dw (EXE_allocsize + 511) / 512 + dw 0 ; relocation information: none + dw (header_end-header_start)/16 ; header size in paragraphs + dw (EXE_absssize + EXE_realstacksize) / 16 ; min extra mem + dw (EXE_absssize + EXE_realstacksize) / 16 ; max extra mem + dw -10h ; Initial SS (before fixup) + dw EXE_endbss + EXE_realstacksize ; Initial SP (1K DPMI+1K STACK) + dw 0 ; (no) Checksum + dw 100h ; Initial IP - start just after the header + dw -10h ; Initial CS (before fixup) + dw 0 ; file offset to relocation table: none + dw 0 ; (no overlay) + align 16,db 0 +header_end: + +EXE_startcode: + section .data +EXE_startdata: + section .bss +EXE_startbss: +%endmacro + +%macro EXE_stack 1 +EXE_realstacksize equ %1 +%define EXE_stack_size EXE_bogusstacksize ; defeat EQU in EXE_end +%endmacro + +%macro EXE_end 0 + section .text +EXE_endcode: + section .data +EXE_enddata: + section .bss + alignb 4 +EXE_endbss: + +EXE_acodesize equ (EXE_endcode-EXE_startcode+3) & (~3) +EXE_datasize equ EXE_enddata-EXE_startdata +EXE_absssize equ (EXE_endbss-EXE_startbss+3) & (~3) +EXE_allocsize equ EXE_acodesize + EXE_datasize + +EXE_stack_size equ 0x800 ; default if nothing else was used +%endmacro diff --git a/vere/ext/nasm/misc/exebin2.mac b/vere/ext/nasm/misc/exebin2.mac new file mode 100644 index 0000000..89c6889 --- /dev/null +++ b/vere/ext/nasm/misc/exebin2.mac @@ -0,0 +1,114 @@ +; -*- nasm -*- + +; NASM macro file to allow the `bin' output format to generate + +; simple .EXE files by constructing the EXE header by hand. + +; Adapted from a contribution by Yann Guidon + + + +%define EXE_stack_size EXE_realstacksize + + + +%macro EXE_begin 0 + + ORG 0E0h + + section .text + + + +header_start: + + db 4Dh,5Ah ; EXE file signature + + dw EXE_allocsize % 512 + + dw (EXE_allocsize + 511) / 512 + + dw 0 ; relocation information: none + + dw (header_end-header_start)/16 ; header size in paragraphs + + dw (EXE_absssize + EXE_realstacksize) / 16 ; min extra mem + + dw (EXE_absssize + EXE_realstacksize) / 16 ; max extra mem + + dw -10h ; Initial SS (before fixup) + + dw EXE_endbss + EXE_realstacksize ; Initial SP (1K DPMI+1K STACK) + + dw 0 ; (no) Checksum + + dw 100h ; Initial IP - start just after the header + + dw -10h ; Initial CS (before fixup) + + dw 0 ; file offset to relocation table: none + + dw 0 ; (no overlay) + + align 16,db 0 + +header_end: + + + +EXE_startcode: + + section .data + +EXE_startdata: + + section .bss + +EXE_startbss: + +%endmacro + + + +%macro EXE_stack 1 + +EXE_realstacksize equ %1 + +%define EXE_stack_size EXE_bogusstacksize ; defeat EQU in EXE_end + +%endmacro + + + +%macro EXE_end 0 + + section .text + +EXE_endcode: + + section .data + +EXE_enddata: + + section .bss + + alignb 4 + +EXE_endbss: + + + +EXE_acodesize equ (EXE_endcode-EXE_startcode+3) & (~3) + +EXE_datasize equ EXE_enddata-EXE_startdata + +EXE_absssize equ (EXE_endbss-EXE_startbss+3) & (~3) + +EXE_allocsize equ EXE_acodesize + EXE_datasize + + + +EXE_stack_size equ 0x800 ; default if nothing else was used + +%endmacro + diff --git a/vere/ext/nasm/misc/fmtinsns.pl b/vere/ext/nasm/misc/fmtinsns.pl new file mode 100755 index 0000000..848ee2d --- /dev/null +++ b/vere/ext/nasm/misc/fmtinsns.pl @@ -0,0 +1,40 @@ +#!/usr/bin/perl +# +# Re-align the columns in insns.dat, and enforce case conventions +# + +@cols = (0, 16, 48, 96); + +while ($line = ) { + chomp $line; + if ($line !~ /^\s*(\;.*|)$/) { + ($ln = $line) =~ s/\s+$//; + if ($line =~ /^\s*(\S+)\s+(\S+)\s+(\S+|\[.*\])\s+(\S+)\s*$/) { + @fields = ($1, $2, $3, $4); + $fields[0] = "\U$fields[0]" unless ($fields[0] =~ /^[^a-z]+cc$/); + $fields[3] =~ s/\,+$//; + $fields[3] = "\U$fields[3]" unless ($fields[3] eq 'ignore'); + $c = 0; + $line = ''; + for ($i = 0; $i < scalar(@fields); $i++) { + if ($i > 0 && $c >= $cols[$i]) { + $line .= ' '; + $c++; + } + while ($c < $cols[$i]) { + $line .= "\t"; + $c = ($c+8) & ~7; + } + $line .= $fields[$i]; + for ($j = 0; $j < length($fields[$i]); $j++) { + if (substr($fields[$i], $j, 1) eq "\t") { + $c = ($c+8) & ~7; + } else { + $c++; + } + } + } + } + } + print $line, "\n"; +} diff --git a/vere/ext/nasm/misc/genfma.pl b/vere/ext/nasm/misc/genfma.pl new file mode 100755 index 0000000..2b6a65c --- /dev/null +++ b/vere/ext/nasm/misc/genfma.pl @@ -0,0 +1,63 @@ +#!/usr/bin/perl +%packed_insns = ( + 'vfmadd' => 0x98, + 'vfmaddsub' => 0x96, + 'vfmsubadd' => 0x97, + 'vfmsub' => 0x9a, + 'vfnmadd' => 0x9c, + 'vfnmsub' => 0x9e + ); + +%scalar_insns = ( + 'vfmadd' => 0x99, + 'vfmsub' => 0x9b, + 'vfnmadd' => 0x9d, + 'vfnmsub' => 0x9f + ); + +foreach $pi ( sort(keys(%packed_insns)) ) { + $op = $packed_insns{$pi}; + foreach $order ('132', '213', '231') { + $xorder = substr($order,1,1).substr($order,0,1).substr($order,2,1); + foreach $o ($order, $xorder) { + for ($w = 0; $w < 2; $w++) { + $suf = $w ? 'pd' : 'ps'; + for ($l = 128; $l <= 256; $l <<= 1) { + $sx = ($l == 256) ? 'SY' : 'SO'; + $mm = ($l == 256) ? 'ymm' : 'xmm'; + printf "%-15s %-31s %-8s%-39s %s\n", + "\U${pi}${o}${suf}", + "${mm}reg,${mm}reg,${mm}rm", + "[rvm:", + sprintf("vex.dds.%d.66.0f38.w%d %02x /r]", + $l, $w, $op), + "FMA,FUTURE,${sx}"; + } + } + } + $op += 0x10; + } +} + +foreach $si ( sort(keys(%scalar_insns)) ) { + $op = $scalar_insns{$si}; + foreach $order ('132', '213', '231') { + $xorder = substr($order,1,1).substr($order,0,1).substr($order,2,1); + foreach $o ($order, $xorder) { + for ($w = 0; $w < 2; $w++) { + $suf = $w ? 'sd' : 'ss'; + $sx = $w ? 'SQ' : 'SD'; + $l = 128; + $mm = 'xmm'; + printf "%-15s %-31s %-8s%-39s %s\n", + "\U${si}${o}${suf}", + "${mm}reg,${mm}reg,${mm}rm", + '[rvm:', + sprintf("vex.dds.%d.66.0f38.w%d %02x /r]", + $l, $w, $op), + "FMA,FUTURE,${sx}"; + } + } + $op += 0x10; + } +} diff --git a/vere/ext/nasm/misc/hints.txt b/vere/ext/nasm/misc/hints.txt new file mode 100644 index 0000000..576e1cf --- /dev/null +++ b/vere/ext/nasm/misc/hints.txt @@ -0,0 +1,26 @@ +Subject: Re: [nasm-devel] P4 insns +Date: Sat, 05 May 2001 11:39:36 -0500 +From: Kyle Markley +Reply-To: nasm-devel@yahoogroups.com +To: nasm-devel@yahoogroups.com + +berkus wrote: +> +> Use The Source, NASM! +> +> Do we have the P4 'probable branch taken' (3e) and 'probable branch +> not taken' (2e) prefixes opcodes? + +They're just segment override prefixes: 2e is CS, 3e is DS. You can just +say +"cs jnz foo" for a not-taken hint, "ds jnz foo" for a taken hint. + +Maybe it would be nice to have a more suggestive name, but you could just +%define one. + +--- +Kyle Markley + + + +Your use of Yahoo! Groups is subject to http://docs.yahoo.com/info/terms/ diff --git a/vere/ext/nasm/misc/magic b/vere/ext/nasm/misc/magic new file mode 100644 index 0000000..0172f4a --- /dev/null +++ b/vere/ext/nasm/misc/magic @@ -0,0 +1,6 @@ +# Put the following lines in your /etc/magic file to get 'file' to recognise +# RDOFF Object Files + +0 string RDOFF RDOFF Object File +>5 byte >32 version %c (little endian) +>5 byte <32 version %d (big endian) diff --git a/vere/ext/nasm/misc/myC32.mac b/vere/ext/nasm/misc/myC32.mac new file mode 100644 index 0000000..e70fc82 --- /dev/null +++ b/vere/ext/nasm/misc/myC32.mac @@ -0,0 +1,121 @@ +; NASM macro set to make interfacing to 32-bit programs easier +; Also cool little macros to make NASM emulate some MASM things. +; +; Originally included in NASM. Modifications by Peter Johnson, 1999. +; + +%imacro proc 1 ; begin a procedure definition +%push proc + global %1 +%1: push ebp + mov ebp, esp +%assign %$arg 8 +;%assign %$argnum 0 +%define %$procname %1 +%endmacro + +%imacro arg 0-1 4 ; used with the argument name as a label +%00 equ %$arg +;%assign %$argnum %$argnum+1 +;.arg%$argnum equ %1 +%assign %$arg %1+%$arg +%endmacro + +%imacro endproc 0 +%ifnctx proc +%error Mismatched `endproc'/`proc' +%else +; mov esp, ebp +; pop ebp +%ifdef LEGACY_ENDPROC + ret +%endif +;__end_%$procname: ; useful for calculating function size +; global %{$procname}_arglen +;%{$procname}_arglen equ %$arg-8 +;%assign %$i 1 +;%rep %$argnum +; global %{$procname}_arg%$i +;%{$procname}_arg%$i equ %{$procname}.arg%$i +;%assign %$i %$i+1 +;%endrep +%pop +%endif +%endmacro + +; redefine ret instructions for in-proc cases +%imacro ret 0-1 +%ifnctx proc + ret %1 +%else + mov esp, ebp + pop ebp + ret %1 +%endif +%endmacro + +%imacro retf 0-1 +%ifnctx proc + retf %1 +%else + mov esp, ebp + pop ebp + retf %1 +%endif +%endmacro + +%imacro retn 0-1 +%ifnctx proc + retn %1 +%else + mov esp, ebp + pop ebp + retn %1 +%endif +%endmacro + +; invoke calls a C function +; defaults to word (16 bit) size parameters +%macro invoke 1-* +%rotate -1 +;%define invoketype word +%rep (%0-1) +; %ifidni %1,dword +; %define invoketype dword +; %elifidni %1,word +; %define invoketype word +; %elifidni %1,byte +; %define invoketype byte +; %else + %ifidni %1, cs + o16 push %1 + %elifidni %1, ds + o16 push %1 + %elifidni %1, es + o16 push %1 + %elifidni %1, fs + o16 push %1 + %elifidni %1, gs + o16 push %1 + %elifidni %1, word cs + o16 push %1 + %elifidni %1, word ds + o16 push %1 + %elifidni %1, word es + o16 push %1 + %elifidni %1, word fs + o16 push %1 + %elifidni %1, word gs + o16 push %1 + %else + push %1 + %endif +; %endif + %rotate -1 +%endrep +call %1 +%if (%0!=1) + add esp, byte %{1}_arglen +%endif +%endmacro + diff --git a/vere/ext/nasm/misc/nasm.sl b/vere/ext/nasm/misc/nasm.sl new file mode 100644 index 0000000..2ddb5c1 --- /dev/null +++ b/vere/ext/nasm/misc/nasm.sl @@ -0,0 +1,320 @@ +% This file defines a NASM editor mode for the JED editor. +% JED's home page is http://space.mit.edu/~davis/jed.html. +% +% To install, copy this file into your JED_LIBRARY directory +% (/usr/local/jed/lib or C:\JED\LIB or whatever), then add the +% following lines to your .jedrc or jed.rc file: +% autoload("nasm_mode", "nasm"); +% add_mode_for_extension("nasm", "asm"); +% (you can of course replace "asm" with whatever file extension +% you like to use for your NASM source files). + +variable Nasm_Instruction_Indent = 10; +variable Nasm_Comment_Column = 33; +variable Nasm_Comment_Space = 1; + +variable nasm_kw_2 = strcat("ahalaxbhblbpbtbxchclcscxdbdddhdidldqdsdtdwdxes", + "fsgsinjajbjcjejgjljojpjsjzorsispssto"); +variable nasm_kw_3 = strncat("a16a32aaaaadaamaasadcaddandbsfbsrbtcbtrbtscbw", + "cdqclccldclicmccmpcr0cr2cr3cr4cwddaadasdecdiv", + "dr0dr1dr2dr3dr6dr7eaxebpebxecxediedxequesiesp", + "farfldfsthltincintjaejbejgejlejmpjnajnbjncjne", + "jngjnljnojnpjnsjnzjpejpolarldslealeslfslgslsl", + "lssltrmm0mm1mm2mm3mm4mm5mm6mm7movmulnegnopnot", + "o16o32outpopporrclrcrrepretrolrorrsmsalsarsbb", + "segshlshrsmist0st1st2st3st4st5st6st7stcstdsti", + "strsubtr3tr4tr5tr6tr7wrtxor", 9); +variable nasm_kw_4 = strncat("arplbytecallcltscwdeemmsfabsfaddfbldfchsfcom", + "fcosfdivfenifildfistfld1fldzfmulfnopfsinfstp", + "fsubftstfxamfxchibtsidivimulinsbinsdinswint1", + "int3intoinvdiretjcxzjnaejnbejngejnlelahflgdt", + "lidtlldtlmswlocklongloopmovdmovqnearpandpopa", + "popfpushpxorreperepzresbresdresqrestreswretf", + "retnsahfsalcsetasetbsetcsetesetgsetlsetosetp", + "setssetzsgdtshldshrdsidtsldtsmswtestumovverr", + "verwwaitwordxaddxbtsxchg", 9); +variable nasm_kw_5 = strncat("boundbswapcmovacmovbcmovccmovecmovgcmovlcmovo", + "cmovpcmovscmovzcmpsbcmpsdcmpswcpuiddwordenter", + "f2xm1faddpfbstpfclexfcomifcompfdisifdivpfdivr", + "ffreefiaddficomfidivfimulfinitfistpfisubfldcw", + "fldpifmulpfpremfptanfsavefsqrtfstcwfstswfsubp", + "fsubrfucomfyl2xicebpint01iretdiretwjecxzleave", + "lodsblodsdlodswloopeloopzmovsbmovsdmovswmovsx", + "movzxoutsboutsdoutswpaddbpadddpaddwpandnpopad", + "popawpopfdpopfwpslldpsllqpsllwpsradpsrawpsrld", + "psrlqpsrlwpsubbpsubdpsubwpushapushfqwordrdmsr", + "rdpmcrdtscrepnerepnzscasbscasdscaswsetaesetbe", + "setgesetlesetnasetnbsetncsetnesetngsetnlsetno", + "setnpsetnssetnzsetpesetposhortstosbstosdstosw", + "timestwordwrmsrxlatb", 14); +variable nasm_kw_6 = strncat("cmovaecmovbecmovgecmovlecmovnacmovnbcmovnc", + "cmovnecmovngcmovnlcmovnocmovnpcmovnscmovnz", + "cmovpecmovpofcmovbfcmovefcmovufcomipfcompp", + "fdivrpficompfidivrfisubrfldenvfldl2efldl2t", + "fldlg2fldln2fpatanfprem1frstorfscalefsetpm", + "fstenvfsubrpfucomifucompincbininvlpgloopne", + "loopnzpaddsbpaddswpmulhwpmullwpsubsbpsubsw", + "pushadpushawpushfdpushfwsetnaesetnbesetnge", + "setnlewbinvd", 9); +variable nasm_kw_7 = strncat("cmovnaecmovnbecmovngecmovnlecmpxchgfcmovbe", + "fcmovnbfcmovnefcmovnufdecstpfincstpfrndint", + "fsincosfucomipfucomppfxtractfyl2xp1loadall", + "paddusbpadduswpcmpeqbpcmpeqdpcmpeqwpcmpgtb", + "pcmpgtdpcmpgtwpmaddwdpsubusbpsubusw", 5); +variable nasm_kw_8 = "fcmovnbepackssdwpacksswbpackuswb"; +variable nasm_kw_9 = strcat("cmpxchg8bpunpckhbwpunpckhdqpunpckhwdpunpcklbw", + "punpckldqpunpcklwd"); +variable nasm_kw_10 = "cmpxchg486loadall286"; + +define nasm_indent_line() { + variable word, len, e, c; + + e = eolp(); + + push_spot(); + EXIT_BLOCK { + pop_spot(); + if (what_column() <= Nasm_Instruction_Indent) + skip_white(); + } + + bol_skip_white(); + c = what_column(); + + if (orelse + {looking_at_char(';')} + {looking_at_char('#')} + {looking_at_char('[')}) { + bol_trim(); + pop_spot(); + EXIT_BLOCK { + } + return; + } + + if (looking_at_char('%')) { + go_right_1(); + !if (orelse + {looking_at_char('$')} + {looking_at_char('%')} + {looking_at_char('+')} + {looking_at_char('-')} + {looking_at_char('0')} + {looking_at_char('1')} + {looking_at_char('2')} + {looking_at_char('3')} + {looking_at_char('4')} + {looking_at_char('5')} + {looking_at_char('6')} + {looking_at_char('7')} + {looking_at_char('8')} + {looking_at_char('9')}) { + bol_trim(); + pop_spot(); + EXIT_BLOCK { + } + return; + } + go_left_1(); + } + + push_mark(); + skip_chars("%$+-"); + skip_chars("0-9a-zA-Z_."); + word = bufsubstr(); + + if (orelse + {c == 1} + {looking_at_char(':')}) { + push_spot(); + bol_trim(); + pop_spot(); + len = strlen(word); + if (looking_at_char(':')) { + go_right_1(); + len++; + } + trim(); + if (e or not(eolp())) { + if (len >= Nasm_Instruction_Indent) { + pop(); + whitespace(1); + } else + whitespace(Nasm_Instruction_Indent - len); + if (e) { + pop_spot(); + eol(); + push_spot(); + } + } + } else { + bol_trim(); + whitespace(Nasm_Instruction_Indent); + } +} + +define nasm_newline_indent() { + push_spot(); + bol_skip_white(); + if (eolp()) + trim(); + pop_spot(); + newline(); + nasm_indent_line(); +} + +define nasm_bol_self_ins() { + push_spot(); + bskip_white(); + bolp(); + pop_spot(); + + call("self_insert_cmd"); + + % Grotty: force immediate update of the syntax highlighting. + insert_char('.'); + deln(left(1)); + + if (()) + nasm_indent_line(); +} + +define nasm_self_ins_ind() { + call("self_insert_cmd"); + + % Grotty: force immediate update of the syntax highlighting. + insert_char('.'); + deln(left(1)); + + nasm_indent_line(); +} + +define nasm_insert_comment() { + variable spc; + + bol_skip_white(); + if (looking_at_char(';')) { + bol_trim(); + go_right(1); + skip_white(); + return; + } else if (eolp()) { + bol_trim(); + insert("; "); + return; + } + + forever { + skip_chars("^;\n'\""); + if (looking_at_char('\'')) { + go_right_1(); + skip_chars("^'\n"); + !if (eolp()) + go_right_1(); + } else if (looking_at_char('\"')) { + go_right_1(); + skip_chars("^\"\n"); + !if (eolp()) + go_right_1(); + } else if (looking_at_char(';')) { + !if (bolp()) { + go_left_1(); + trim(); + !if (looking_at_char(';')) + go_right_1(); + } + break; + } else { + break; + } + } + spc = Nasm_Comment_Column - what_column(); + if (spc < Nasm_Comment_Space) + spc = Nasm_Comment_Space; + whitespace(spc); + if (eolp()) { + insert("; "); + } else { + go_right_1(); + skip_white(); + } +} + +$1 = "NASM"; +create_syntax_table($1); + +define_syntax (";", "", '%', $1); +define_syntax ("([", ")]", '(', $1); +define_syntax ('"', '"', $1); +define_syntax ('\'', '\'', $1); +define_syntax ("0-9a-zA-Z_.@#", 'w', $1); +define_syntax ("-+0-9a-fA-F.xXL", '0', $1); +define_syntax (",:", ',', $1); +define_syntax ('%', '#', $1); +define_syntax ("|^&<>+-*/%~", '+', $1); + +set_syntax_flags($1,1); + +#ifdef HAS_DFA_SYNTAX + +dfa_enable_highlight_cache("nasm.dfa", $1); +dfa_define_highlight_rule(";.*$", "comment", $1); +dfa_define_highlight_rule("[A-Za-z_\\.\\?][A-Za-z0-9_\\.\\?\\$#@~]*", + "Knormal", $1); +dfa_define_highlight_rule("$([A-Za-z_\\.\\?][A-Za-z0-9_\\.\\?\\$#@~]*)?", + "normal", $1); +dfa_define_highlight_rule("[0-9]+(\\.[0-9]*)?([Ee][\\+\\-]?[0-9]*)?", + "number", $1); +dfa_define_highlight_rule("[0-9]+[QqBb]", "number", $1); +dfa_define_highlight_rule("(0x|\\$[0-9A-Fa-f])[0-9A-Fa-f]*", "number", $1); +dfa_define_highlight_rule("[0-9A-Fa-f]+[Hh]", "number", $1); +dfa_define_highlight_rule("\"[^\"]*\"", "string", $1); +dfa_define_highlight_rule("\"[^\"]*$", "string", $1); +dfa_define_highlight_rule("'[^']*'", "string", $1); +dfa_define_highlight_rule("'[^']*$", "string", $1); +dfa_define_highlight_rule("[\\(\\)\\[\\],:]*", "delimiter", $1); +dfa_define_highlight_rule("^[ \t]*#", "PQpreprocess", $1); +dfa_define_highlight_rule("^[ \t]*\\%{?[^%\\$\\+\\-0-9]", "PQpreprocess", $1); +dfa_define_highlight_rule("^%$", "preprocess", $1); +dfa_define_highlight_rule("[\\|\\^&<>\\+\\-\\*/%~]*", "operator", $1); +dfa_define_highlight_rule("%([%\\$]?-?[0-9A-Za-z_\\.\\?\\$~@]+|{[^}]*}?)", + "preprocess", $1); +dfa_define_highlight_rule("[ \t]*", "normal", $1); +dfa_define_highlight_rule(".", "normal", $1); +dfa_build_highlight_table($1); +#endif + +define_keywords_n($1, nasm_kw_2, 2, 0); +define_keywords_n($1, nasm_kw_3, 3, 0); +define_keywords_n($1, nasm_kw_4, 4, 0); +define_keywords_n($1, nasm_kw_5, 5, 0); +define_keywords_n($1, nasm_kw_6, 6, 0); +define_keywords_n($1, nasm_kw_7, 7, 0); +define_keywords_n($1, nasm_kw_8, 8, 0); +define_keywords_n($1, nasm_kw_9, 9, 0); +define_keywords_n($1, nasm_kw_10, 10, 0); + +define_keywords_n($1, "org", 3, 1); +define_keywords_n($1, "bitsiend", 4, 1); +define_keywords_n($1, "aligngroupstruc", 5, 1); +define_keywords_n($1, "alignbcommonexternglobalistruc", 6, 1); +define_keywords_n($1, "sectionsegmentlibrary", 7, 1); +define_keywords_n($1, "absoluteendstruc", 8, 1); +define_keywords_n($1, "uppercase", 9, 1); + +!if (keymap_p ($1)) make_keymap ($1); +definekey("nasm_bol_self_ins", ";", $1); +definekey("nasm_bol_self_ins", "#", $1); +definekey("nasm_bol_self_ins", "%", $1); +definekey("nasm_bol_self_ins", "[", $1); +definekey("nasm_self_ins_ind", ":", $1); +definekey("nasm_insert_comment", "^[;", $1); + +define nasm_mode() { + set_mode("NASM", 4); + use_keymap ("NASM"); + use_syntax_table ("NASM"); + set_buffer_hook ("indent_hook", "nasm_indent_line"); + set_buffer_hook ("newline_indent_hook", "nasm_newline_indent"); + runhooks("nasm_mode_hook"); +} diff --git a/vere/ext/nasm/misc/nasmstab b/vere/ext/nasm/misc/nasmstab new file mode 100644 index 0000000..32ef67e --- /dev/null +++ b/vere/ext/nasm/misc/nasmstab @@ -0,0 +1,296 @@ +#!/usr/bin/perl + +sub StabLine ($ $ $ $ $ $) { + local ($comment,$n_strx,$type,$other,$desc,$value) = @_; + print $comment; + print "","dd",$n_strx; + print "","db",$type; + print "","db",$other; + print "","dw",$desc; + print "","dd","0" . $value . "h"; +} + +sub RStabLine ($ $ $ $ $) { + local ($comment,$offset,$info,$type,$symbol) = @_; + print $comment; + print "","dd",$offset; + print "","db",$type; + print "","db",$symbol; + print "","dw",$info; +} + +#this sub exists because i've no idea how to print non-ascii numbers in perl + +sub OutBin ( $ $ ) { + local ($offset, $shnum) = @_; + seek(FINAL,$offset,0); + if ( $shnum == 2 ) { printf FINAL "\x02" } ; + if ( $shnum == 3 ) { printf FINAL "\x03" } ; + if ( $shnum == 4 ) { printf FINAL "\x04" } ; + if ( $shnum == 5 ) { printf FINAL "\x05" } ; + if ( $shnum == 6 ) { printf FINAL "\x06" } ; + if ( $shnum == 7 ) { printf FINAL "\x07" } ; + if ( $shnum == 8 ) { printf FINAL "\x08" } ; + if ( $shnum == 9 ) { printf FINAL "\x09" } ; + if ( $shnum == 10 ) { printf FINAL "\x0a" } ; + if ( $shnum == 11 ) { printf FINAL "\x0b" } ; + if ( $shnum == 12 ) { printf FINAL "\x0c" } ; + if ( $shnum == 13 ) { printf FINAL "\x0d" } ; + if ( $shnum == 14 ) { printf FINAL "\x0e" } ; + if ( $shnum == 15 ) { printf FINAL "\x0f" } ; +} + +sub DispHelp () { + $\="\n"; + print "Usage:"; + print "\t-f,--input-file"; + print "\t\tThe input file name (only required option)"; + print "\t-o,--output-file"; + print "\t\tThe output file name (if not specified, *.asm becomes *.o"; + print "\t\tand anything else becomes a.out)"; + print "\t-l,--list-file"; + print "\t\tThe listing file's name (default: trailing .asm is +removed"; + print "\t\tif there and .lst is appended)"; + print "\t-s,--second-asm-file"; + print "\t\tThe second asm file's name (default: trailing .asm is"; + print "\t\tremoved if there and .nasm is appended)"; + print "\n"; + exit ; +} + +if ( $ARGV[0] eq "" ) { $ARGV[0] = "-h" }; + +$i = 0; +$filename = ""; +$outname = ""; + +while ( $ARGV[$i] ne "" ) { + $_ = $ARGV[$i]; + if ( m/^-/ ) { + if ( m/^-f$/ ) { $filename = $ARGV[++$i] }; + if ( m/^-o$/ ) { $outname = $ARGV[++$i] }; + if ( m/^-l$/ ) { $listname = $ARGV[++$i] }; + if ( m/^-s$/ ) { $asmname = $ARGV[++$i] }; + if ( m/^-h$/ ) { DispHelp }; + } elsif ( m/^--\w+/ ) { + if ( m/^--input-file$/ ) { $filename = $ARGV[++$i] }; + if ( m/^--output-file$/ ) { $outname = $ARGV[++$i] }; + if ( m/^--list-file$/ ) { $listname = $ARGV[++$i] }; + if ( m/^--second-asm-file$/ ) { $asmname = $ARGV[++$i] }; + if ( m/^--help/ ) { DispHelp }; + } elsif ( m/^--$/ ) { + while ( $ARGV[++$i] ) { + $NasmOptions .= " "; + $NasmOptions .= $_; + }; + } else { + DispHelp() + }; + $i++; +}; + +if ( $filename eq "" ) { DispHelp() }; + +if ( $outname eq "" ) { + $outname = $filename; + $outname =~ s/\.asm/.o/; + if ( $outname eq $filename ) { $outname = "a.out" }; +}; + +if ( $listname eq "" ) { + $listname = $filename; + $listname =~ s/\.asm//; + $listname .= ".lst"; +}; + +if ( $asmname eq "" ) { + $asmname = $filename; + $asmname =~ s/\.asm//; + $asmname .= ".nasm"; +}; + +$err = `nasm -f elf ${filename} -l ${listname} -o ${outname} `; + +if ( $err ) { die "\n$err\n"}; + +open(LISTFILE,"${listname}") or die "\n $0: Could not reopen list file!\n"; +open(ASMFILE,">${asmname}") or die "\n $0: Could not open asm file!\n"; + +select ASMFILE; + +open(OLDASM,$filename) or die "\n$0: Cannot open file $filename\n"; + +while ( $x = ) { + print $x; +} + +@stab = ("n_desc", "value"); +@rel_stab = ("offset"); +$i = 0; +$current_section = ""; +$has_text = 'FALSE'; +$midst_of_macro = 'FALSE'; +$line_dec = 0 ; + +while ( $x = ) { + if ( $x =~ m/[^;]*%include/ ) { + $x = ; + while ( $x =~ m/\s+\d+\s+\<\d+\>\s+/ ) { + $x = ; + $line_dec++; + } + } + if ( $current_section eq ".text" ) { + if ( $x =~ m/^\s+(\S+)\s+(\S+)\s+(\S+)\s+[^<]+$/ ) { + $stab[$i++] = $1-$line_dec; #linenum + $stab[$i++] = $2; #offset + $count++; + if ( $3 =~ m/-/ ) { + $x = ; + $line_dec++; + } + $midst_of_macro = 'FALSE'; + } elsif ( $x =~ m/^\s+(\S+)\s+(\S+)\s+(\S+)\s+<\d+>/ ) { + if ( $midst_of_macro eq 'TRUE' ) { + $stab[$i] = $stab[$i-2]; #same linenum + $line_dec++; + } else { + $stab[$i] = $1 - ++$line_dec; + $midst_of_macro = 'TRUE'; + } + $count++; + $i++; + $stab[$i++] = $2; + if ( $3 =~ m/-/ ) { + $x = ; + $line_dec++; + } + + } + $has_text = 'TRUE'; + } elsif ( $x =~ m/\s+\S+\s+\S+\s+\S+\s+<\d+>/ ) { # is it a macro? + $line_dec++; + } + if ( $x =~ s/(section|segment)\s+([^\s]+)/$2/ ) { + $current_section = $2; + } +}; + +close LISTFILE; + +unless ( $has_text eq "TRUE" ) { + $err = `nasm -f elf ${asmname} -o ${outname}`; + print STDERR $err; + exit; +} + +#Write Stab section +$, = "\t"; #output field separator +$\ = "\n"; #output record separator + +print "section .stab noalloc"; +StabLine(";header",1,0,0,$count+1,length($filename)*2+3); +StabLine(";so",length($asmname)+2,"064h",0,0,0); + +$offset = 12; +$i = 0; +$j = 0; +$rel_stab[$j++] = $offset + 8; + +while ( $stab[$i] ) { + StabLine(";N_SLINE" . " " . ( ($i+2) / 2 ), 0, "044h", 0, + $stab[$i++], $stab[$i++]); + $offset += 12; + $rel_stab[$j++] = $offset + 8; +} + +#Write .rel.stab section +print "\n\nsection .rel.stab noalloc"; + +open (READELF,"readelf -s ${outname} |") or die "\n$0: Could not run readelf\n"; + +while ( $x = ) { + if ( $x =~ m/\s+(\d+):\s+00000000\s+\d+\s+SECTION\s+\w+\s+\w+\s+1\s+/){ $textsymnum = $1; + }; +}; +close READELF; + +$i = 0; + +while ( $rel_stab[$i] ne "" ) { + RStabLine(";relocation for N_SLINE " . ($i), $rel_stab[$i], 0, 1, $textsymnum); + $i++; +} ; + +#Write .stabstr section + +print "\n\nsection .stabstr noalloc"; + +print "","db","0"; +print "","db",'"' . $asmname . '"'; +print "","db","0"; +print "","db",'"' . $asmname . '"' ; +print "","db","0"; + +close ASMFILE; + +$err = `nasm -f elf ${asmname} -o ${outname}`; + +if ( $err ) { die "\n$err\n" } ; + +open (READELF,"readelf -h -S ${outname} |") or die "\n$0: Could not run readelf\n"; + + +while ( $x = ) { + if ( $x =~ m/Start\s+of\s+section\s+headers:\s+(\d+)\s+/ ) { + $shoff = $1; + } + if ( $x =~ m/Size\s+of\s+section\s+headers:\s+(\d+)\s+/ ) { + $shentsize = $1; + } + if ( $x =~ m/\[\s*(\d+)\]\s+.rel.stab\s+/ ) { + $relnum = $1; + } + if ( $x =~ m/\[\s*(\d+)\]\s+.stab\s+/ ) { + $stabnum = $1; + } + if ( $x =~ m/\[\s*(\d+)\]\s+.stabstr\s+/ ) { + $stabstrnum = $1; + } + if ( $x =~ m/\[\s*(\d+)\]\s+.symtab\s+/ ) { + $symtabnum = $1; + } +} +close READELF; + +sysopen (FINAL,"${outname}",2,0) or die "\n$0: Could not open ${outname}"; +$, = ""; #output field separator +$\ = ""; #output record separator + +#set .rel.stab->type to rel +OutBin($shoff + ($shentsize * $relnum) + 4,9); + +#set .rel.stab->link to .symtab +OutBin($shoff + ($shentsize * $relnum) + 24,$symtabnum); + +#set .rel.stab->info to .stab +OutBin($shoff + ($shentsize * $relnum) + 28,$stabnum); + +#set .rel.stab->entsize to 8 +OutBin($shoff + ($shentsize * $relnum) + 36,8); + +#set .stab->link to .stabstr +OutBin($shoff + ($shentsize * $stabnum) + 24,$stabstrnum); + +#set .stab->entsize to 12 +OutBin($shoff + ($shentsize * $stabnum) + 36,12); + +#set .stabstr->type to strtab +OutBin($shoff + ($shentsize * $stabstrnum) + 4,3); + +close FINAL; + +#Date: 17 Mar 2002 15:51:20 -0800 +#From: kitsred@hotmail.com (kired) +#Newsgroups: alt.lang.asm diff --git a/vere/ext/nasm/misc/omfdump.c b/vere/ext/nasm/misc/omfdump.c new file mode 100644 index 0000000..b27e7c9 --- /dev/null +++ b/vere/ext/nasm/misc/omfdump.c @@ -0,0 +1,516 @@ +/* + * omfdump.c + * + * Very simple program to dump the contents of an OMF (OBJ) file + * + * This assumes a littleendian, unaligned-load-capable host and a + * C compiler which handles basic C99. + */ + +#include +#include +#include +#include +#include +#include +#include +#include +#include + +const char *progname; + +static const char *record_types[256] = +{ + [0x80] = "THEADR", + [0x82] = "LHEADR", + [0x88] = "COMENT", + [0x8a] = "MODEND16", + [0x8b] = "MODEND32", + [0x8c] = "EXTDEF", + [0x90] = "PUBDEF16", + [0x91] = "PUBDEF32", + [0x94] = "LINNUM16", + [0x95] = "LINNUM32", + [0x96] = "LNAMES", + [0x98] = "SEGDEF16", + [0x99] = "SEGDEF32", + [0x9a] = "GRPDEF", + [0x9c] = "FIXUPP16", + [0x9d] = "FIXUPP32", + [0xa0] = "LEDATA16", + [0xa1] = "LEDATA32", + [0xa2] = "LIDATA16", + [0xa3] = "LIDATA32", + [0xb0] = "COMDEF", + [0xb2] = "BAKPAT16", + [0xb3] = "BAKPAT32", + [0xb4] = "LEXTDEF", + [0xb6] = "LPUBDEF16", + [0xb7] = "LPUBDEF32", + [0xb8] = "LCOMDEF", + [0xbc] = "CEXTDEF", + [0xc2] = "COMDAT16", + [0xc3] = "COMDAT32", + [0xc4] = "LINSYM16", + [0xc5] = "LINSYM32", + [0xc6] = "ALIAS", + [0xc8] = "NBKPAT16", + [0xc9] = "NBKPAT32", + [0xca] = "LLNAMES", + [0xcc] = "VERNUM", + [0xce] = "VENDEXT", + [0xf0] = "LIBHDR", + [0xf1] = "LIBEND", +}; + +typedef void (*dump_func)(uint8_t, const uint8_t *, size_t); + +/* Ordered collection type */ +struct collection { + size_t n; /* Elements in collection (not including 0) */ + size_t s; /* Elements allocated (not including 0) */ + const void **p; /* Element pointers */ +}; + +struct collection c_names, c_lsegs, c_groups, c_extsym; + +static void nomem(void) +{ + fprintf(stderr, "%s: memory allocation error\n", progname); + exit(1); +} + +#define INIT_SIZE 64 +static void add_collection(struct collection *c, const void *p) +{ + if (c->n >= c->s) { + size_t cs = c->s ? (c->s << 1) : INIT_SIZE; + const void **cp = realloc(c->p, cs*sizeof(const void *)); + + if (!cp) + nomem(); + + c->p = cp; + c->s = cs; + + memset(cp + c->n, 0, (cs - c->n)*sizeof(const void *)); + } + + c->p[++c->n] = p; +} + +static const void *get_collection(struct collection *c, size_t index) +{ + if (index >= c->n) + return NULL; + + return c->p[index]; +} + +static void hexdump_data(unsigned int offset, const uint8_t *data, + size_t n, size_t field) +{ + unsigned int i, j; + + for (i = 0; i < n; i += 16) { + printf(" %04x: ", i+offset); + for (j = 0; j < 16; j++) { + char sep = (j == 7) ? '-' : ' '; + if (i+j < field) + printf("%02x%c", data[i+j], sep); + else if (i+j < n) + printf("xx%c", sep); /* Beyond end of... */ + else + printf(" "); /* No separator */ + } + printf(" : "); + for (j = 0; j < 16; j++) { + if (i+j < n) + putchar((i+j >= field) ? 'x' : + isprint(data[i+j]) ? data[i+j] : '.'); + } + putchar('\n'); + } +} + +static void dump_unknown(uint8_t type, const uint8_t *data, size_t n) +{ + (void)type; + hexdump_data(0, data, n, n); +} + +static void print_dostime(const uint8_t *p) +{ + uint16_t da = (p[3] << 8) + p[2]; + uint16_t ti = (p[1] << 8) + p[0]; + + printf("%04u-%02u-%02u %02u:%02u:%02u", + (da >> 9) + 1980, (da >> 5) & 15, da & 31, + (ti >> 11), (ti >> 5) & 63, (ti << 1) & 63); +} + +static void dump_coment_depfile(uint8_t type, const uint8_t *data, size_t n) +{ + if (n > 4 && data[4] == n-5) { + printf(" # "); + print_dostime(data); + printf(" %.*s\n", n-5, data+5); + } + + hexdump_data(2, data, n, n); +} + +static const dump_func dump_coment_class[256] = { + [0xe9] = dump_coment_depfile +}; + +static void dump_coment(uint8_t type, const uint8_t *data, size_t n) +{ + uint8_t class; + static const char *coment_class[256] = { + [0x00] = "Translator", + [0x01] = "Copyright", + [0x81] = "Library specifier", + [0x9c] = "MS-DOS version", + [0x9d] = "Memory model", + [0x9e] = "DOSSEG", + [0x9f] = "Library search", + [0xa0] = "OMF extensions", + [0xa1] = "New OMF extension", + [0xa2] = "Link pass separator", + [0xa3] = "LIBMOD", + [0xa4] = "EXESTR", + [0xa6] = "INCERR", + [0xa7] = "NOPAD", + [0xa8] = "WKEXT", + [0xa9] = "LZEXT", + [0xda] = "Comment", + [0xdb] = "Compiler", + [0xdc] = "Date", + [0xdd] = "Timestamp", + [0xdf] = "User", + [0xe3] = "Type definition", + [0xe8] = "Filename", + [0xe9] = "Dependency file", + [0xff] = "Command line" + }; + + if (n < 2) { + hexdump_data(type, data, 2, n); + return; + } + + type = data[0]; + class = data[1]; + + printf(" [NP=%d NL=%d UD=%02X] %02X %s\n", + (type >> 7) & 1, + (type >> 6) & 1, + type & 0x3f, + class, + coment_class[class] ? coment_class[class] : "???"); + + if (dump_coment_class[class]) + dump_coment_class[class](class, data+2, n-2); + else + hexdump_data(2, data+2, n-2, n-2); +} + +/* Parse an index field */ +static uint16_t get_index(const uint8_t **pp) +{ + uint8_t c; + + c = *(*pp)++; + if (c & 0x80) { + return ((c & 0x7f) << 8) + *(*pp)++; + } else { + return c; + } +} + +static uint16_t get_16(const uint8_t **pp) +{ + uint16_t v = *(const uint16_t *)(*pp); + (*pp) += 2; + + return v; +} + +static uint32_t get_32(const uint8_t **pp) +{ + const uint32_t v = *(const uint32_t *)(*pp); + (*pp) += 4; + + return v; +} + +/* Returns a name as a C string in a newly allocated buffer */ +char *lname(int index) +{ + char *s; + const char *p = get_collection(&c_names, index); + size_t len; + + if (!p) + return NULL; + + len = (uint8_t)p[0]; + + s = malloc(len+1); + if (!s) + nomem(); + + memcpy(s, p+1, len); + s[len] = '\0'; + + return s; +} + +/* LNAMES or LLNAMES */ +static void dump_lnames(uint8_t type, const uint8_t *data, size_t n) +{ + const uint8_t *p = data; + const uint8_t *end = data + n; + + while (p < end) { + size_t l = *p+1; + if (l > n) { + add_collection(&c_names, NULL); + printf(" # %4u 0x%04x: \"%.*s... <%zu missing bytes>\n", + c_names.n, c_names.n, n-1, p+1, l-n); + } else { + add_collection(&c_names, p); + printf(" # %4u 0x%04x: \"%.*s\"\n", + c_names.n, c_names.n, l-1, p+1); + } + hexdump_data(p-data, p, l, n); + p += l; + n -= l; + } +} + +/* SEGDEF16 or SEGDEF32 */ +static void dump_segdef(uint8_t type, const uint8_t *data, size_t n) +{ + bool big = type & 1; + const uint8_t *p = data; + const uint8_t *end = data+n; + uint8_t attr; + static const char * const alignment[8] = + { "ABS", "BYTE", "WORD", "PARA", "PAGE", "DWORD", "LTL", "?ALIGN" }; + static const char * const combine[8] = + { "PRIVATE", "?COMMON", "PUBLIC", "?COMBINE", "?PUBLIC", "STACK", "COMMON", "?PUBLIC" }; + uint16_t idx; + char *s; + + if (p >= end) + return; + + attr = *p++; + + printf(" # %s (A%u) %s (C%u) %s%s", + alignment[(attr >> 5) & 7], (attr >> 5) & 7, + combine[(attr >> 2) & 7], (attr >> 2) & 7, + (attr & 0x02) ? "MAXSIZE " : "", + (attr & 0x01) ? "USE32" : "USE16"); + + if (((attr >> 5) & 7) == 0) { + /* Absolute segment */ + if (p+3 > end) + goto dump; + printf(" AT %04x:", get_16(&p)); + printf("%02x", *p++); + } + + if (big) { + if (p+4 > end) + goto dump; + printf(" size 0x%08x", get_32(&p)); + } else { + if (p+2 > end) + goto dump; + printf(" size 0x%04x", get_16(&p)); + } + + idx = get_index(&p); + if (p > end) + goto dump; + s = lname(idx); + printf(" name '%s'", s); + + idx = get_index(&p); + if (p > end) + goto dump; + s = lname(idx); + printf(" class '%s'", s); + + idx = get_index(&p); + if (p > end) + goto dump; + s = lname(idx); + printf(" ovl '%s'", s); + +dump: + putchar('\n'); + hexdump_data(0, data, n, n); +} + +/* FIXUPP16 or FIXUPP32 */ +static void dump_fixupp(uint8_t type, const uint8_t *data, size_t n) +{ + bool big = type & 1; + const uint8_t *p = data; + const uint8_t *end = data + n; + static const char * const method_base[4] = + { "SEGDEF", "GRPDEF", "EXTDEF", "frame#" }; + + while (p < end) { + const uint8_t *start = p; + uint8_t op = *p++; + uint16_t index; + uint32_t disp; + + if (!(op & 0x80)) { + /* THREAD record */ + bool frame = !!(op & 0x40); + + printf(" THREAD %-7s%d%s method %c%d (%s)", + frame ? "frame" : "target", op & 3, + (op & 0x20) ? " +flag5?" : "", + (op & 0x40) ? 'F' : 'T', + op & 3, method_base[op & 3]); + + if ((op & 0x50) != 0x50) { + printf(" index 0x%04x", get_index(&p)); + } + putchar('\n'); + } else { + /* FIXUP subrecord */ + uint8_t fix; + + printf(" FIXUP %s-rel location %2d offset 0x%03x", + (op & 0x40) ? "seg" : "self", + (op & 0x3c) >> 2, + ((op & 3) << 8) + *p++); + + fix = *p++; + printf("\n frame %s%d%s", + (fix & 0x80) ? "thread " : "F", + ((fix & 0x70) >> 4), + ((fix & 0xc0) == 0xc0) ? "?" : ""); + + if ((fix & 0xc0) == 0) + printf(" datum 0x%04x", get_index(&p)); + + printf("\n target %s%d", + (fix & 0x10) ? "thread " : "method T", + fix & 3); + + if ((fix & 0x10) == 0) + printf(" (%s)", method_base[fix & 3]); + + printf(" datum 0x%04x", get_index(&p)); + + if ((fix & 0x08) == 0) { + if (big) { + printf(" disp 0x%08x", get_32(&p)); + } else { + printf(" disp 0x%04x", get_16(&p)); + } + } + putchar('\n'); + } + hexdump_data(start-data, start, p-start, n-(start-data)); + } +} + +static const dump_func dump_type[256] = +{ + [0x88] = dump_coment, + [0x96] = dump_lnames, + [0x98] = dump_segdef, + [0x99] = dump_segdef, + [0x9c] = dump_fixupp, + [0x9d] = dump_fixupp, + [0xca] = dump_lnames, +}; + +int dump_omf(int fd) +{ + struct stat st; + size_t len, n; + uint8_t type; + const uint8_t *p, *data; + + if (fstat(fd, &st)) + return -1; + + len = st.st_size; + + data = mmap(NULL, len, PROT_READ, MAP_PRIVATE, fd, 0); + if (data == MAP_FAILED) + return -1; + + p = data; + while (len >= 3) { + uint8_t csum; + int i; + + type = p[0]; + n = *(uint16_t *)(p+1); + + printf("%02x %-10s %4zd bytes", + type, + record_types[type] ? record_types[type] : "???", + n); + + if (len < n+3) { + printf("\n (truncated, only %zd bytes left)\n", len-3); + break; /* Truncated */ + } + + p += 3; /* Header doesn't count in the length */ + n--; /* Remove checksum byte */ + + csum = 0; + for (i = -3; i < (int)n; i++) + csum -= p[i]; + + printf(", checksum %02X", p[i]); + if (csum == p[i]) + printf(" (valid)\n"); + else + printf(" (actual = %02X)\n", csum); + + if (dump_type[type]) + dump_type[type](type, p, n); + else + dump_unknown(type, p, n); + + p += n+1; + len -= (n+4); + } + + munmap((void *)data, st.st_size); + return 0; +} + +int main(int argc, char *argv[]) +{ + int fd; + int i; + + progname = argv[0]; + + for (i = 1; i < argc; i++) { + fd = open(argv[i], O_RDONLY); + if (fd < 0 || dump_omf(fd)) { + perror(argv[i]); + return 1; + } + close(fd); + } + + return 0; +} diff --git a/vere/ext/nasm/misc/pmw.bat b/vere/ext/nasm/misc/pmw.bat new file mode 100644 index 0000000..88b67a5 --- /dev/null +++ b/vere/ext/nasm/misc/pmw.bat @@ -0,0 +1,9 @@ +@echo off +rem some batch file to bind nasm and ndisasm with pmode/w +rem a mega cool dos extender for watcom done by tran +rem +rem max 8 megs, dpmi stack 256*16=4096, no banner +pmwlite.exe nasm.exe +pmwsetup.exe /X8388608 /P256 /B0 nasm.exe +pmwlite.exe ndisasm.exe +pmwsetup.exe /X8388608 /P256 /B0 ndisasm.exe diff --git a/vere/ext/nasm/misc/proc32.ash b/vere/ext/nasm/misc/proc32.ash new file mode 100644 index 0000000..b0633ec --- /dev/null +++ b/vere/ext/nasm/misc/proc32.ash @@ -0,0 +1,441 @@ +;--------=========xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx=========-------- +; +; Copyright (C) 1999 by Andrew Zabolotny +; Miscellaneous NASM macros that makes use of new preprocessor features +; +; This library is free software; you can redistribute it and/or +; modify it under the terms of the GNU Library General Public +; License as published by the Free Software Foundation; either +; version 2 of the License, or (at your option) any later version. +; +; This library is distributed in the hope that it will be useful, +; but WITHOUT ANY WARRANTY; without even the implied warranty of +; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +; Library General Public License for more details. +; +; You should have received a copy of the GNU Library General Public +; License along with this library; if not, write to the Free +; Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. +; +;--------=========xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx=========-------- + +; The macros in this file provides support for writing 32-bit C-callable +; NASM routines. For a short description of every macros see the +; corresponding comment before every one. Simple usage example: +; +; proc sin,1 +; targ %$angle +; fld %$angle +; fsin +; endproc sin + +%ifndef __PROC32_ASH__ +%define __PROC32_ASH__ + +[WARNING -macro-selfref] + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Mangle a name to be compatible with the C compiler +; Arguments: +; The name +; Example: +; cname (my_func) +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%ifdef EXTERNC_UNDERSCORE + %define cname(x) _ %+ x +%else + %define cname(x) x +%endif + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Import an external C procedure definition +; Arguments: +; The name of external C procedure +; Example: +; cextern printf +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro cextern 1 + %xdefine %1 cname(%1) + %ifidni __OUTPUT_FORMAT__,obj + extern %1:wrt FLAT + %else + extern %1 + %endif +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Export an C procedure definition +; Arguments: +; The name of C procedure +; Example: +; cglobal my_printf +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro cglobal 1 + %xdefine %1 cname(%1) + global %1 +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Misc macros to deal with PIC shared libraries +; Comment: +; Note that we have a different syntax for working with and without +; PIC shared libraries. In a PIC environment we should load first +; the address of the variable into a register and then work through +; that address, i.e: mov eax,myvar; mov [eax],1 +; In a non-PIC environment we should directly write: mov myvar,1 +; Example: +; extvar myvar +; GetGOT +; %ifdef PIC +; mov ebx,myvar ; get offset of myvar into ebx +; %else +; lea ebx,myvar +; %endif +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%ifdef PIC + cextern _GLOBAL_OFFSET_TABLE_ + %macro GetGOT 0 + %ifdef .$proc.stkofs + %assign .$proc.stkofs .$proc.stkofs+4 + %endif + call %$Get_GOT + %$Get_GOT: + pop ebx + add ebx,_GLOBAL_OFFSET_TABLE_ + $$ - %$Get_GOT wrt ..gotpc + %endmacro + %macro extvar 1 + cextern %1 + %xdefine %1 [ebx+%1 wrt ..got] + %endmacro +%else + %define GetGOT + %macro extvar 1 + cextern %1 + %endmacro +%endif + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Begin a procedure definition +; For performance reasons we don't use stack frame pointer EBP, +; instead we're using the [esp+xx] addressing. Because of this +; you should be careful when you work with stack pointer. +; The push/pop instructions are macros that are defined to +; deal correctly with these issues. +; Arguments: +; First argument - the procedure name +; Second optional argument - the number of bytes for local variables +; The following arguments could specify the registers that should be +; pushed at beginning of procedure and popped before exiting +; Example: +; proc MyTestProc +; proc MyTestProc,4,ebx,esi,edi +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro proc 1-3+ 0 + cglobal %1 + %push %1 + align 16 +%1: + %xdefine %$proc.name %1 + ; total size of local arguments + %assign %$proc.locsize (%2+3) & 0xFFFC + ; offset from esp to argument + %assign %$proc.argofs 4+%$proc.locsize + ; additional offset to args (tracks push/pops) + %assign .$proc.stkofs 0 + ; offset from esp to local arguments + %assign %$proc.locofs 0 + ; Now push the registers that we should save + %define %$proc.save %3 + %if %$proc.locsize != 0 + sub esp,%$proc.locsize + %endif + push %$proc.save +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Declare an argument passed on stack +; This macro defines two additional macros: +; first (with the name given by first argument) - [esp+xx] +; second (with a underscore appended to first argument) - esp+xx +; Arguments: +; First argument defines the procedure argument name +; Second optional parameter defines the size of the argument +; Default value is 4 (a double word) +; Example: +; arg .my_float +; arg .my_double,8 +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro arg 1-2 4 + %ifndef %$proc.argofs + %error "`arg' not in a proc context" + %else + ; Trick: temporary undefine .$proc.stkofs so that it won't be expanded + %assign %%. .$proc.stkofs + %undef .$proc.stkofs + %xdefine %{1}_ esp+%$proc.argofs+.$proc.stkofs + %xdefine %1 [esp+%$proc.argofs+.$proc.stkofs] + %assign .$proc.stkofs %%. + %assign %$proc.argofs %2+%$proc.argofs + %endif +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Declare an local variable +; first (with the name given by first argument) - [esp+xx] +; second (with a slash prefixing the first argument) - esp+xx +; Arguments: +; First argument defines the procedure argument name +; Second optional parameter defines the size of the argument +; Default value is 4 (a double word) +; Example: +; loc .int_value +; loc .double_value,8 +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro loc 1-2 4 + %ifndef %$proc.locofs + %error "`loc' not in a proc context" + %elif %$proc.locofs + %2 > %$proc.locsize + %error "local stack space exceeded" + %else + %assign %%. .$proc.stkofs + %undef .$proc.stkofs + %xdefine %{1}_ esp+%$proc.locofs+.$proc.stkofs + %xdefine %1 [esp+%$proc.locofs+.$proc.stkofs] + %assign .$proc.stkofs %%. + %assign %$proc.locofs %$proc.locofs+%2 + %endif +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Get the type of given size into context-local variable %$type +; Arguments: +; Size of type we want (1,2,4,8 or 10) +; Example: +; type 4 ; gives "dword" +; type 10 ; gives "tword" +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro type 1 + %if %1 = 1 + %define %$type byte + %elif %1 = 2 + %define %$type word + %elif %1 = 4 + %define %$type dword + %elif %1 = 8 + %define %$type qword + %elif %1 = 10 + %define %$type tword + %else + %define %$. %1 + %error "unknown type for argument size %$." + %endif +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Same as `arg' but prepends "word", "dword" etc (typed arg) +; first (with the name given by first argument) - dword [esp+xx] +; second (with a slash prefixing the first argument) - esp+xx +; Arguments: +; Same as for `arg' +; Example: +; targ .my_float ; .my_float is now "dword [esp+xxx]" +; targ .my_double,8 ; .my_double is now "qword [esp+xxx]" +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro targ 1-2 4 + %ifndef %$proc.argofs + %error "`targ' not in a proc context" + %else + arg %1,%2 + type %2 + %assign %%. .$proc.stkofs + %undef .$proc.stkofs + %xdefine %1 %$type %1 + %assign .$proc.stkofs %%. + %endif +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Same as `loc' but prepends "word", "dword" etc (typed loc) +; first (with the name given by first argument) - dword [esp+xx] +; second (with a slash prefixing the first argument) - esp+xx +; Arguments: +; Same as for `loc' +; Example: +; tloc int_value +; tloc double_value,8 +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro tloc 1-2 4 + %ifndef %$proc.locofs + %error "`tloc' not in a proc context" + %else + loc %1,%2 + type %2 + %assign %%. .$proc.stkofs + %undef .$proc.stkofs + %xdefine %1 %$type %1 + %assign .$proc.stkofs %%. + %endif +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Finish a procedure +; Gives an error if proc/endproc pairs mismatch +; Defines an label called __end_(procedure name) +; which is useful for calculating function size +; Arguments: +; (optional) The name of procedure +; Example: +; endproc MyTestProc +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%push tmp ; trick: define a dummy context to avoid error in next line +%macro endproc 0-1 %$proc.name + %ifndef %$proc.argofs + %error "`endproc' not in a proc context" + %elifnidn %$proc.name,%1 + %define %$. %1 + %error "endproc names mismatch: expected `%$proc.name'" + %error "but got `%$.' instead" + %elif %$proc.locofs < %$proc.locsize + %error "unused local space declared (used %$proc.locofs, requested %$proc.locsize)" + %else +%$exit: + ; Now pop the registers that we should restore on exit + pop %$proc.save + %if %$proc.locsize != 0 + add esp,%$proc.locsize + %endif + ret +__end_%1: + %pop + %endif +%endmacro +%pop + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; A replacement for "push" for use within procedures +; Arguments: +; any number of registers which will be push'ed successively +; Example: +; push eax,ebx,ecx,edx +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro push 0-* +; dummy comment to avoid problems with "push" on the same line with a label + %rep %0 + push %1 + %rotate 1 + %assign .$proc.stkofs .$proc.stkofs+4 + %endrep +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; A replacement for "pop" for use within procedures +; Arguments: +; any number of registers which will be pop'ed in reverse order +; Example: +; pop eax,ebx,ecx,edx +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro pop 0-* +; dummy comment to avoid problems with "pop" on the same line with a label + %rep %0 + %rotate -1 + pop %1 + %assign .$proc.stkofs .$proc.stkofs-4 + %endrep +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Replacements for "pushfd" and "popfd" that takes care of esp +; Example: +; pushfd +; popfd +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro pushfd 0 + pushfd + %assign .$proc.stkofs .$proc.stkofs+4 +%endmacro +%macro popfd 0 + popfd + %assign .$proc.stkofs .$proc.stkofs-4 +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Exit from current procedure (optionally on given condition) +; Arguments: +; Either none or a condition code +; Example: +; exit +; exit nz +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro exit 0-1 mp + j%1 near %$exit +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; start an conditional branch +; Arguments: +; A condition code +; second (optional) argument - "short" (by default - "near") +; Example: +; if nz +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro if 1-2 near +; dummy comment to avoid problems with "if" on the same line with a label + %push if + j%-1 %2 %$elseif +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; define the "else" branch of a conditional statement +; Arguments: +; optionally: "short" if jmp to endif is less than 128 bytes away +; Example: +; else +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro else 0-1 + %ifnctx if + %error "`else' without matching `if'" + %else + jmp %1 %$endif +%$elseif: + %define %$elseif_defined + %endif +%endmacro + +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +; Summary: +; Finish am conditional statement +; Arguments: +; none +; Example: +; endif +;-----======xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx======----- +%macro endif 0 + %ifnctx if + %error "`endif' without matching `if'" + %else + %ifndef %$elseif_defined +%$elseif: + %endif +%$endif: + %pop + %endif +%endmacro + +%endif ; __PROC32_ASH__ diff --git a/vere/ext/nasm/misc/scitech.mac b/vere/ext/nasm/misc/scitech.mac new file mode 100644 index 0000000..5fe0470 --- /dev/null +++ b/vere/ext/nasm/misc/scitech.mac @@ -0,0 +1,1222 @@ +;**************************************************************************** +;* +;* ======================================================================== +;* +;* The contents of this file are subject to the SciTech MGL Public +;* License Version 1.0 (the "License"); you may not use this file +;* except in compliance with the License. You may obtain a copy of +;* the License at http://www.scitechsoft.com/mgl-license.txt +;* +;* Software distributed under the License is distributed on an +;* "AS IS" basis, WITHOUT WARRANTY OF ANY KIND, either express or +;* implied. See the License for the specific language governing +;* rights and limitations under the License. +;* +;* The Original Code is Copyright (C) 1991-1998 SciTech Software, Inc. +;* +;* The Initial Developer of the Original Code is SciTech Software, Inc. +;* All Rights Reserved. +;* +;* ======================================================================== +;* +;* Language: NetWide Assembler (NASM) or Turbo Assembler (TASM) +;* Environment: Any Intel Environment +;* +;* Description: Macros to provide memory model independent assembly language +;* module for C programming. Supports the large and flat memory +;* models. +;* +;* The defines that you should use when assembling modules that +;* use this macro package are: +;* +;* __LARGE__ Assemble for 16-bit large model +;* __FLAT__ Assemble for 32-bit FLAT memory model +;* __NOU__ No underscore for all external C labels +;* __NOU_VAR__ No underscore for global variables only +;* +;* The default settings are for 16-bit large memory model with +;* leading underscores for symbol names. +;* +;* The main intent of the macro file is to enable programmers +;* to write _one_ set of source that can be assembled to run +;* in either 16 bit real and protected modes or 32 bit +;* protected mode without the need to riddle the code with +;* 'if flatmodel' style conditional assembly (it is still there +;* but nicely hidden by a macro layer that enhances the +;* readability and understandability of the resulting code). +;* +;**************************************************************************** + +; Include the appropriate version in here depending on the assembler. NASM +; appears to always try and parse code, even if it is in a non-compiling +; block of a ifdef expression, and hence crashes if we include the TASM +; macro package in the same header file. Hence we split the macros up into +; two separate header files. + +ifdef __NASM_MAJOR__ + +;============================================================================ +; Macro package when compiling with NASM. +;============================================================================ + +; Turn off underscores for globals if disabled for all externals + +%ifdef __NOU__ +%define __NOU_VAR__ +%endif + +; Define the __WINDOWS__ symbol if we are compiling for any Windows +; environment + +%ifdef __WINDOWS16__ +%define __WINDOWS__ 1 +%endif +%ifdef __WINDOWS32__ +%define __WINDOWS__ 1 +%define __WINDOWS32_386__ 1 +%endif + +; Macros for accessing 'generic' registers + +%ifdef __FLAT__ +%idefine _ax eax +%idefine _bx ebx +%idefine _cx ecx +%idefine _dx edx +%idefine _si esi +%idefine _di edi +%idefine _bp ebp +%idefine _sp esp +%idefine _es +%idefine UCHAR BYTE ; Size of a character +%idefine USHORT WORD ; Size of a short +%idefine UINT DWORD ; Size of an integer +%idefine ULONG DWORD ; Size of a long +%idefine BOOL DWORD ; Size of a boolean +%idefine DPTR DWORD ; Size of a data pointer +%idefine FDPTR FWORD ; Size of a far data pointer +%idefine NDPTR DWORD ; Size of a near data pointer +%idefine CPTR DWORD ; Size of a code pointer +%idefine FCPTR FWORD ; Size of a far code pointer +%idefine NCPTR DWORD ; Size of a near code pointer +%idefine FPTR NEAR ; Distance for function pointers +%idefine DUINT dd ; Declare a integer variable +%idefine intsize 4 +%idefine flatmodel 1 +%else +%idefine _ax ax +%idefine _bx bx +%idefine _cx cx +%idefine _dx dx +%idefine _si si +%idefine _di di +%idefine _bp bp +%idefine _sp sp +%idefine _es es: +%idefine UCHAR BYTE ; Size of a character +%idefine USHORT WORD ; Size of a short +%idefine UINT WORD ; Size of an integer +%idefine ULONG DWORD ; Size of a long +%idefine BOOL WORD ; Size of a boolean +%idefine DPTR DWORD ; Size of a data pointer +%idefine FDPTR DWORD ; Size of a far data pointer +%idefine NDPTR WORD ; Size of a near data pointer +%idefine CPTR DWORD ; Size of a code pointer +%idefine FCPTR DWORD ; Size of a far code pointer +%idefine NCPTR WORD ; Size of a near code pointer +%idefine FPTR FAR ; Distance for function pointers +%idefine DUINT dw ; Declare a integer variable +%idefine intsize 2 +%endif +%idefine invert ~ +%idefine offset +%idefine use_nasm + +; Convert all jumps to near jumps, since NASM does not so this automatically + +%idefine jo jo near +%idefine jno jno near +%idefine jz jz near +%idefine jnz jnz near +%idefine je je near +%idefine jne jne near +%idefine jb jb near +%idefine jbe jbe near +%idefine ja ja near +%idefine jae jae near +%idefine jl jl near +%idefine jle jle near +%idefine jg jg near +%idefine jge jge near +%idefine jc jc near +%idefine jnc jnc near +%idefine js js near +%idefine jns jns near + +%ifdef DOUBLE +%idefine REAL QWORD +%idefine DREAL dq +%else +%idefine REAL DWORD +%idefine DREAL dd +%endif + +; Boolean truth values (same as those in debug.h) + +%idefine False 0 +%idefine True 1 +%idefine No 0 +%idefine Yes 1 + +; Macro to be invoked at the start of all modules to set up segments for +; later use. Does nothing for NASM. + +%imacro header 1 +%endmacro + +; Macro to begin a data segment + +%imacro begdataseg 1 +%ifdef __GNUC__ +segment .data public class=DATA use32 flat +%else +%ifdef flatmodel +segment _DATA public align=4 class=DATA use32 flat +%else +segment _DATA public align=4 class=DATA use16 +%endif +%endif +%endmacro + +; Macro to end a data segment + +%imacro enddataseg 1 +%endmacro + +; Macro to begin a code segment + +%imacro begcodeseg 1 +%ifdef __GNUC__ +segment .text public class=CODE use32 flat +%else +%ifdef flatmodel +segment _TEXT public align=16 class=CODE use32 flat +%else +segment %1_TEXT public align=16 class=CODE use16 +%endif +%endif +%endmacro + +; Macro to begin a near code segment + +%imacro begcodeseg_near 0 +%ifdef __GNUC__ +segment .text public class=CODE use32 flat +%else +%ifdef flatmodel +segment _TEXT public align=16 class=CODE use32 flat +%else +segment _TEXT public align=16 class=CODE use16 +%endif +%endif +%endmacro + +; Macro to end a code segment + +%imacro endcodeseg 1 +%endmacro + +; Macro to end a near code segment + +%imacro endcodeseg_near 0 +%endmacro + +; Macro for an extern C symbol. If the C compiler requires leading +; underscores, then the underscores are added to the symbol names, otherwise +; they are left off. The symbol name is referenced in the assembler code +; using the non-underscored symbol name. + +%imacro cextern 2 +%ifdef __NOU_VAR__ +extern %1 +%else +extern _%1 +%define %1 _%1 +%endif +%endmacro + +%imacro cexternfunc 2 +%ifdef __NOU__ +extern %1 +%else +extern _%1 +%define %1 _%1 +%endif +%endmacro + +; Macro for a public C symbol. If the C compiler requires leading +; underscores, then the underscores are added to the symbol names, otherwise +; they are left off. The symbol name is referenced in the assembler code +; using the non-underscored symbol name. + +%imacro cpublic 1 +%ifdef __NOU_VAR__ +global %1 +%1: +%else +global _%1 +_%1: +%define %1 _%1 +%endif +%endmacro + +; Macro for an global C symbol. If the C compiler requires leading +; underscores, then the underscores are added to the symbol names, otherwise +; they are left off. The symbol name is referenced in the assembler code +; using the non-underscored symbol name. + +%imacro cglobal 1 +%ifdef __NOU_VAR__ +global %1 +%else +global _%1 +%define %1 _%1 +%endif +%endmacro + +; Macro for an global C function symbol. If the C compiler requires leading +; underscores, then the underscores are added to the symbol names, otherwise +; they are left off. The symbol name is referenced in the assembler code +; using the non-underscored symbol name. + +%imacro cglobalfunc 1 +%ifdef __NOU__ +global %1 +%else +global _%1 +%define %1 _%1 +%endif +%endmacro + +; Macro to start a C callable function. This will be a far function for +; 16-bit code, and a near function for 32-bit code. + +%imacro cprocstatic 1 +%push cproc +%1: +%ifdef flatmodel +%stacksize flat +%define ret retn +%else +%stacksize large +%define ret retf +%endif +%assign %$localsize 0 +%endmacro + +%imacro cprocstart 1 +%push cproc + cglobalfunc %1 +%1: +%ifdef flatmodel +%stacksize flat +%define ret retn +%else +%stacksize large +%define ret retf +%endif +%assign %$localsize 0 +%endmacro + +; This macro sets up a procedure to be exported from a 16 bit DLL. Since the +; calling conventions are always _far _pascal for 16 bit DLL's, we actually +; rename this routine with an extra underscore with 'C' calling conventions +; and a small DLL stub will be provided by the high level code to call the +; assembler routine. + +%imacro cprocstartdll16 1 +%ifdef __WINDOWS16__ +cprocstart _%1 +%else +cprocstart %1 +%endif +%endmacro + +; Macro to start a C callable near function. + +%imacro cprocnear 1 +%push cproc + cglobalfunc %1 +%1: +%define ret retn +%ifdef flatmodel +%stacksize flat +%else +%stacksize small +%endif +%assign %$localsize 0 +%endmacro + +; Macro to start a C callable far function. + +%imacro cprocfar 1 +%push cproc + cglobalfunc %1 +%1: +%define ret retf +%ifdef flatmodel +%stacksize flat +%else +%stacksize large +%endif +%assign %$localsize 0 +%endmacro + +; Macro to end a C function + +%imacro cprocend 0 +%pop +%endmacro + +; Macros for entering and exiting C callable functions. Note that we must +; always save and restore the SI and DI registers for C functions, and for +; 32 bit C functions we also need to save and restore EBX and clear the +; direction flag. + +%imacro enter_c 0 + push _bp + mov _bp,_sp +%ifnidn %$localsize,0 + sub _sp,%$localsize +%endif +%ifdef flatmodel + push ebx +%endif + push _si + push _di +%endmacro + +%imacro leave_c 0 + pop _di + pop _si +%ifdef flatmodel + pop ebx + cld +%endif +%ifnidn %$localsize,0 + mov _sp,_bp +%endif + pop _bp +%endmacro + +%imacro use_ebx 0 +%ifdef flatmodel + push ebx +%endif +%endmacro + +%imacro unuse_ebx 0 +%ifdef flatmodel + pop ebx +%endif +%endmacro + +; Macros for saving and restoring the value of DS,ES,FS,GS when it is to +; be used in assembly routines. This evaluates to nothing in the flat memory +; model, but is saves and restores DS in the large memory model. + +%imacro use_ds 0 +%ifndef flatmodel + push ds +%endif +%endmacro + +%imacro unuse_ds 0 +%ifndef flatmodel + pop ds +%endif +%endmacro + +%imacro use_es 0 +%ifndef flatmodel + push es +%endif +%endmacro + +%imacro unuse_es 0 +%ifndef flatmodel + pop es +%endif +%endmacro + +; Macros for loading the address of a data pointer into a segment and +; index register pair. The %imacro explicitly loads DS or ES in the 16 bit +; memory model, or it simply loads the offset into the register in the flat +; memory model since DS and ES always point to all addressable memory. You +; must use the correct _REG (ie: _BX) %imacros for documentation purposes. + +%imacro _lds 2 +%ifdef flatmodel + mov %1,%2 +%else + lds %1,%2 +%endif +%endmacro + +%imacro _les 2 +%ifdef flatmodel + mov %1,%2 +%else + les %1,%2 +%endif +%endmacro + +; Macros for adding and subtracting a value from registers. Two value are +; provided, one for 16 bit modes and another for 32 bit modes (the extended +; register is used in 32 bit modes). + +%imacro _add 3 +%ifdef flatmodel + add e%1, %3 +%else + add %1, %2 +%endif +%endmacro + +%imacro _sub 3 +%ifdef flatmodel + sub e%1, %3 +%else + sub %1, %2 +%endif +%endmacro + +; Macro to clear the high order word for the 32 bit extended registers. +; This is used to convert an unsigned 16 bit value to an unsigned 32 bit +; value, and will evaluate to nothing in 16 bit modes. + +%imacro clrhi 1 +%ifdef flatmodel + movzx e%1,%1 +%endif +%endmacro + +%imacro sgnhi 1 +%ifdef flatmodel + movsx e%1,%1 +%endif +%endmacro + +; Macro to load an extended register with an integer value in either mode + +%imacro loadint 2 +%ifdef flatmodel + mov e%1,%2 +%else + xor e%1,e%1 + mov %1,%2 +%endif +%endmacro + +; Macros to load and store integer values with string instructions + +%imacro LODSINT 0 +%ifdef flatmodel + lodsd +%else + lodsw +%endif +%endmacro + +%imacro STOSINT 0 +%ifdef flatmodel + stosd +%else + stosw +%endif +%endmacro + +; Macros to provide resb, resw, resd compatibility with NASM + +%imacro dclb 1 +times %1 db 0 +%endmacro + +%imacro dclw 1 +times %1 dw 0 +%endmacro + +%imacro dcld 1 +times %1 dd 0 +%endmacro + +; macros to declare assembler function stubs for function structures + +%imacro BEGIN_STUBS_DEF 2 +begdataseg _STUBS +%ifdef __NOU_VAR__ +extern %1 +%define STUBS_START %1 +%else +extern _%1 +%define STUBS_START _%1 +%endif +enddataseg _STUBS +begcodeseg _STUBS +%assign off %2 +%endmacro + +%imacro DECLARE_STUB 1 +%ifdef __NOU__ + global %1 +%1: +%else + global _%1 +_%1: +%endif + jmp [DWORD STUBS_START+off] +%assign off off+4 +%endmacro + +%imacro DECLARE_STDCALL 2 +%ifdef STDCALL_MANGLE + global _%1@%2 +_%1@%2: +%else +%ifdef __GNUC__ + global _%1 +_%1: +%else + global %1 +%1: +%endif +%endif + jmp [DWORD STUBS_START+off] +%assign off off+4 +%endmacro + +%imacro END_STUBS_DEF 0 +endcodeseg _STUBS +%endmacro + +; macros to declare assembler import stubs for binary loadable drivers + +%imacro BEGIN_IMPORTS_DEF 1 +BEGIN_STUBS_DEF %1,4 +%endmacro + +%imacro DECLARE_IMP 1 +DECLARE_STUB %1 +%endmacro + +%imacro END_IMPORTS_DEF 0 +END_STUBS_DEF +%endmacro + +else ; __NASM_MAJOR__ + +;============================================================================ +; Macro package when compiling with TASM. +;============================================================================ + +; Turn off underscores for globals if disabled for all externals + +ifdef __NOU__ +__NOU_VAR__ = 1 +endif + +; Define the __WINDOWS__ symbol if we are compiling for any Windows +; environment + +ifdef __WINDOWS16__ +__WINDOWS__ = 1 +endif +ifdef __WINDOWS32__ +__WINDOWS__ = 1 +__WINDOWS32_386__ = 1 +endif +ifdef __WIN386__ +__WINDOWS__ = 1 +__WINDOWS32_386__ = 1 +endif +ifdef __VXD__ +__WINDOWS__ = 1 +__WINDOWS32_386__ = 1 + MASM + .386 + NO_SEGMENTS = 1 + include vmm.inc ; IGNORE DEPEND + include vsegment.inc ; IGNORE DEPEND + IDEAL +endif + +; Macros for accessing 'generic' registers + +ifdef __FLAT__ + _ax EQU eax ; EAX is used for accumulator + _bx EQU ebx ; EBX is used for accumulator + _cx EQU ecx ; ECX is used for looping + _dx EQU edx ; EDX is used for data register + _si EQU esi ; ESI is the source index register + _di EQU edi ; EDI is the destination index register + _bp EQU ebp ; EBP is used for base pointer register + _sp EQU esp ; ESP is used for stack pointer register + _es EQU ; ES and DS are the same in 32 bit PM + typedef UCHAR BYTE ; Size of a character + typedef USHORT WORD ; Size of a short + typedef UINT DWORD ; Size of an integer + typedef ULONG DWORD ; Size of a long + typedef BOOL DWORD ; Size of a boolean + typedef DPTR DWORD ; Size of a data pointer + typedef FDPTR FWORD ; Size of a far data pointer + typedef NDPTR DWORD ; Size of a near data pointer + typedef CPTR DWORD ; Size of a code pointer + typedef FCPTR FWORD ; Size of a far code pointer + typedef NCPTR DWORD ; Size of a near code pointer + typedef DUINT DWORD ; Declare a integer variable + FPTR EQU NEAR ; Distance for function pointers + intsize = 4 ; Size of an integer + flatmodel = 1 ; This is a flat memory model + P386 ; Turn on 386 code generation + MODEL FLAT ; Set up for 32 bit simplified FLAT model +else + _ax EQU ax ; AX is used for accumulator + _bx EQU bx ; BX is used for accumulator + _cx EQU cx ; CX is used for looping + _dx EQU dx ; DX is used for data register + _si EQU si ; SI is the source index register + _di EQU di ; DI is the destination index register + _bp EQU bp ; BP is used for base pointer register + _sp EQU sp ; SP is used for stack pointer register + _es EQU es: ; ES is used for segment override + typedef UCHAR BYTE ; Size of a character + typedef USHORT WORD ; Size of a short + typedef UINT WORD ; Size of an integer + typedef ULONG DWORD ; Size of a long + typedef BOOL WORD ; Size of a boolean + typedef DPTR DWORD ; Size of a data pointer + typedef FDPTR DWORD ; Size of a far data pointer + typedef NDPTR WORD ; Size of a near data pointer + typedef CPTR DWORD ; Size of a code pointer + typedef FCPTR DWORD ; Size of a far code pointer + typedef NCPTR WORD ; Size of a near code pointer + typedef DUINT WORD ; Declare a integer variable + FPTR EQU FAR ; Distance for function pointers + intsize = 2 ; Size of an integer + P386 ; Turn on 386 code generation +endif + invert EQU not + +; Provide a typedef for real floating point numbers + +ifdef DOUBLE +typedef REAL QWORD +typedef DREAL QWORD +else +typedef REAL DWORD +typedef DREAL DWORD +endif + +; Macros to access the floating point stack registers to convert them +; from NASM style to TASM style + +st0 EQU st(0) +st1 EQU st(1) +st2 EQU st(2) +st3 EQU st(3) +st4 EQU st(4) +st5 EQU st(5) +st6 EQU st(6) +st7 EQU st(7) +st8 EQU st(8) + +; Boolean truth values (same as those in debug.h) + +ifndef __VXD__ +False = 0 +True = 1 +No = 0 +Yes = 1 +Yes = 1 +endif + +; Macros for the _DATA data segment. This segment contains initialised data. + +MACRO begdataseg name +ifdef __VXD__ + MASM +VXD_LOCKED_DATA_SEG + IDEAL +else +ifdef flatmodel + DATASEG +else +SEGMENT _DATA DWORD PUBLIC USE16 'DATA' +endif +endif +ENDM + +MACRO enddataseg name +ifdef __VXD__ + MASM +VXD_LOCKED_DATA_ENDS + IDEAL +else +ifndef flatmodel +ENDS _DATA +endif +endif +ENDM + +; Macro for the main code segment. + +MACRO begcodeseg name +ifdef __VXD__ + MASM +VXD_LOCKED_CODE_SEG + IDEAL +else +ifdef flatmodel + CODESEG + ASSUME CS:FLAT,DS:FLAT,SS:FLAT +else +SEGMENT &name&_TEXT PARA PUBLIC USE16 'CODE' + ASSUME CS:&name&_TEXT,DS:_DATA +endif +endif +ENDM + +; Macro for a near code segment + +MACRO begcodeseg_near +ifdef flatmodel + CODESEG + ASSUME CS:FLAT,DS:FLAT,SS:FLAT +else +SEGMENT _TEXT PARA PUBLIC USE16 'CODE' + ASSUME CS:_TEXT,DS:_DATA +endif +ENDM + +MACRO endcodeseg name +ifdef __VXD__ + MASM +VXD_LOCKED_CODE_ENDS + IDEAL +else +ifndef flatmodel +ENDS &name&_TEXT +endif +endif +ENDM + +MACRO endcodeseg_near +ifndef flatmodel +ENDS _TEXT +endif +ENDM + +; Macro to be invoked at the start of all modules to set up segments for +; later use. + +MACRO header name +begdataseg name +enddataseg name +ENDM + +; Macro for an extern C symbol. If the C compiler requires leading +; underscores, then the underscores are added to the symbol names, otherwise +; they are left off. The symbol name is referenced in the assembler code +; using the non-underscored symbol name. + +MACRO cextern name,size +ifdef __NOU_VAR__ + EXTRN name:size +else + EXTRN _&name&:size +name EQU _&name& +endif +ENDM + +MACRO cexternfunc name,size +ifdef __NOU__ + EXTRN name:size +else + EXTRN _&name&:size +name EQU _&name& +endif +ENDM + +MACRO stdexternfunc name,args,size +ifdef STDCALL_MANGLE + EXTRN _&name&@&num_args&:size +name EQU _&name&@&num_args +else + EXTRN name:size +endif +ENDM + +; Macro for a public C symbol. If the C compiler requires leading +; underscores, then the underscores are added to the symbol names, otherwise +; they are left off. The symbol name is referenced in the assembler code +; using the non-underscored symbol name. + +MACRO cpublic name +ifdef __NOU_VAR__ +name: + PUBLIC name +else +_&name&: + PUBLIC _&name& +name EQU _&name& +endif +ENDM + +; Macro for an global C symbol. If the C compiler requires leading +; underscores, then the underscores are added to the symbol names, otherwise +; they are left off. The symbol name is referenced in the assembler code +; using the non-underscored symbol name. + +MACRO cglobal name +ifdef __NOU_VAR__ + PUBLIC name +else + PUBLIC _&name& +name EQU _&name& +endif +ENDM + +; Macro for an global C function symbol. If the C compiler requires leading +; underscores, then the underscores are added to the symbol names, otherwise +; they are left off. The symbol name is referenced in the assembler code +; using the non-underscored symbol name. + +MACRO cglobalfunc name +ifdef __NOU__ + PUBLIC name +else + PUBLIC _&name& +name EQU _&name& +endif +ENDM + +; Macro to start a C callable function. This will be a far function for +; 16-bit code, and a near function for 32-bit code. + +MACRO cprocstatic name ; Set up model independent private proc +ifdef flatmodel +PROC name NEAR +else +PROC name FAR +endif +LocalSize = 0 +ENDM + +MACRO cprocstart name ; Set up model independent proc +ifdef flatmodel +ifdef __NOU__ +PROC name NEAR +else +PROC _&name& NEAR +endif +else +ifdef __NOU__ +PROC name FAR +else +PROC _&name& FAR +endif +endif +LocalSize = 0 + cglobalfunc name +ENDM + +MACRO cprocnear name ; Set up near proc +ifdef __NOU__ +PROC name NEAR +else +PROC _&name& NEAR +endif +LocalSize = 0 + cglobalfunc name +ENDM + +MACRO cprocfar name ; Set up far proc +ifdef __NOU__ +PROC name FAR +else +PROC _&name& FAR +endif +LocalSize = 0 + cglobalfunc name +ENDM + +MACRO cprocend ; End procedure macro +ENDP +ENDM + +; This macro sets up a procedure to be exported from a 16 bit DLL. Since the +; calling conventions are always _far _pascal for 16 bit DLL's, we actually +; rename this routine with an extra underscore with 'C' calling conventions +; and a small DLL stub will be provided by the high level code to call the +; assembler routine. + +MACRO cprocstartdll16 name +ifdef __WINDOWS16__ +cprocstart _&name& +else +cprocstart name +endif +ENDM + +; Macros for entering and exiting C callable functions. Note that we must +; always save and restore the SI and DI registers for C functions, and for +; 32 bit C functions we also need to save and restore EBX and clear the +; direction flag. + +MACRO save_c_regs +ifdef flatmodel + push ebx +endif + push _si + push _di +ENDM + +MACRO enter_c + push _bp + mov _bp,_sp + IFDIFI ,<0> + sub _sp,LocalSize + ENDIF + save_c_regs +ENDM + +MACRO restore_c_regs + pop _di + pop _si +ifdef flatmodel + pop ebx +endif +ENDM + +MACRO leave_c + restore_c_regs + cld + IFDIFI ,<0> + mov _sp,_bp + ENDIF + pop _bp +ENDM + +MACRO use_ebx +ifdef flatmodel + push ebx +endif +ENDM + +MACRO unuse_ebx +ifdef flatmodel + pop ebx +endif +ENDM + +; Macros for saving and restoring the value of DS,ES,FS,GS when it is to +; be used in assembly routines. This evaluates to nothing in the flat memory +; model, but is saves and restores DS in the large memory model. + +MACRO use_ds +ifndef flatmodel + push ds +endif +ENDM + +MACRO unuse_ds +ifndef flatmodel + pop ds +endif +ENDM + +MACRO use_es +ifndef flatmodel + push es +endif +ENDM + +MACRO unuse_es +ifndef flatmodel + pop es +endif +ENDM + +; Macros for loading the address of a data pointer into a segment and +; index register pair. The macro explicitly loads DS or ES in the 16 bit +; memory model, or it simply loads the offset into the register in the flat +; memory model since DS and ES always point to all addressable memory. You +; must use the correct _REG (ie: _BX) macros for documentation purposes. + +MACRO _lds reg, addr +ifdef flatmodel + mov reg,addr +else + lds reg,addr +endif +ENDM + +MACRO _les reg, addr +ifdef flatmodel + mov reg,addr +else + les reg,addr +endif +ENDM + +; Macros for adding and subtracting a value from registers. Two value are +; provided, one for 16 bit modes and another for 32 bit modes (the extended +; register is used in 32 bit modes). + +MACRO _add reg, val16, val32 +ifdef flatmodel + add e®&, val32 +else + add reg, val16 +endif +ENDM + +MACRO _sub reg, val16, val32 +ifdef flatmodel + sub e®&, val32 +else + sub reg, val16 +endif +ENDM + +; Macro to clear the high order word for the 32 bit extended registers. +; This is used to convert an unsigned 16 bit value to an unsigned 32 bit +; value, and will evaluate to nothing in 16 bit modes. + +MACRO clrhi reg +ifdef flatmodel + movzx e®&,reg +endif +ENDM + +MACRO sgnhi reg +ifdef flatmodel + movsx e®&,reg +endif +ENDM + +; Macro to load an extended register with an integer value in either mode + +MACRO loadint reg,val +ifdef flatmodel + mov e®&,val +else + xor e®&,e®& + mov reg,val +endif +ENDM + +; Macros to load and store integer values with string instructions + +MACRO LODSINT +ifdef flatmodel + lodsd +else + lodsw +endif +ENDM + +MACRO STOSINT +ifdef flatmodel + stosd +else + stosw +endif +ENDM + +; Macros to provide resb, resw, resd compatibility with NASM + +MACRO dclb count +db count dup (0) +ENDM + +MACRO dclw count +dw count dup (0) +ENDM + +MACRO dcld count +dd count dup (0) +ENDM + +; Macros to provide resb, resw, resd compatibility with NASM + +MACRO resb count +db count dup (?) +ENDM + +MACRO resw count +dw count dup (?) +ENDM + +MACRO resd count +dd count dup (?) +ENDM + +; Macros to declare assembler stubs for function structures + +MACRO BEGIN_STUBS_DEF name, firstOffset +begdataseg _STUBS +ifdef __NOU_VAR__ + EXTRN name:DWORD +STUBS_START = name +else + EXTRN _&name&:DWORD +name EQU _&name& +STUBS_START = _&name +endif +enddataseg _STUBS +begcodeseg _STUBS +off = firstOffset +ENDM + +MACRO DECLARE_STUB name +ifdef __NOU__ +name: + PUBLIC name +else +_&name: + PUBLIC _&name +endif + jmp [DWORD STUBS_START+off] +off = off + 4 +ENDM + +MACRO DECLARE_STDCALL name,num_args +ifdef STDCALL_MANGLE +_&name&@&num_args&: + PUBLIC _&name&@&num_args& +else +name: + PUBLIC name +endif + jmp [DWORD STUBS_START+off] +off = off + 4 +ENDM + +MACRO END_STUBS_DEF +endcodeseg _STUBS +ENDM + +MACRO BEGIN_IMPORTS_DEF name +BEGIN_STUBS_DEF name,4 +ENDM + +MACRO DECLARE_IMP name +DECLARE_STUB name +ENDM + +MACRO END_IMPORTS_DEF +END_STUBS_DEF +ENDM + +endif diff --git a/vere/ext/nasm/misc/xcrcgen.c b/vere/ext/nasm/misc/xcrcgen.c new file mode 100644 index 0000000..0198480 --- /dev/null +++ b/vere/ext/nasm/misc/xcrcgen.c @@ -0,0 +1,79 @@ +/* + * Produce a "generalized CRC" table. Assumes a platform with + * /dev/urandom -- otherwise reimplement get_random_byte(). + */ + +#include +#include +#include +#include +#include +#include + +static uint8_t get_random_byte(void) +{ + static int fd = -1; + uint8_t buf; + int rv; + + if (fd < 0) + fd = open("/dev/urandom", O_RDONLY); + + do { + errno = 0; + rv = read(fd, &buf, 1); + if (rv < 1 && errno != EAGAIN) + abort(); + } while (rv < 1); + + return buf; +} + +static void random_permute(uint8_t *buf) +{ + int i, j, k; + int m; + + for (i = 0; i < 256; i++) + buf[i] = i; + + m = 255; + for (i = 255; i > 0; i--) { + if (i <= (m >> 1)) + m >>= 1; + do { + j = get_random_byte() & m; + } while (j > i); + k = buf[i]; + buf[i] = buf[j]; + buf[j] = k; + } +} + +static void xcrc_table(uint64_t *buf) +{ + uint8_t perm[256]; + int i, j; + + memset(buf, 0, 8*256); /* Make static checkers happy */ + + for (i = 0; i < 8; i++) { + random_permute(perm); + for (j = 0; j < 256; j++) + buf[j] = (buf[j] << 8) | perm[j]; + } +} + +int main(void) +{ + int i; + uint64_t buf[256]; + + xcrc_table(buf); + + for (i = 0; i < 256; i++) { + printf("%016"PRIx64"\n", buf[i]); + } + + return 0; +} -- cgit v1.2.3